/usr/bin
NameSizeModeActions
2to3950755editdlrm
ab834160755editdlrm
aclocal363760755editdlrm
aclocal-1.16363760755editdlrm
acyclic156640755editdlrm
addr2line284080755editdlrm
alias330755editdlrm
animate154560755editdlrm
appstream-compose322240755editdlrm
appstream-util1193680755editdlrm
apropos496880755editdlrm
apropos.man-db496880755editdlrm
ar573280755editdlrm
arch322240755editdlrm
arpaname154720755editdlrm
arping279040755editdlrm
as7273600755editdlrm
aserver404160755editdlrm
aspell1547440755editdlrm
at568244755editdlrm
atq568244755editdlrm
atrm568244755editdlrm
attr154960755editdlrm
audit2allow150640755editdlrm
audit2why150640755editdlrm
aulast196640755editdlrm
aulastlog154880755editdlrm
ausyscall154800755editdlrm
authselect447280755editdlrm
autoconf147710755editdlrm
autoheader85340755editdlrm
autom4te321810755editdlrm
automake2579810755editdlrm
automake-1.162579810755editdlrm
autopoint269970755editdlrm
autoreconf210660755editdlrm
autoscan171240755editdlrm
autoupdate338720755editdlrm
auvirt361520755editdlrm
avinfo239280755editdlrm
awk7149280755editdlrm
b2sum528320755editdlrm
base32363440755editdlrm
base64363440755editdlrm
basename322400755editdlrm
basenc489760755editdlrm
bash13890240755editdlrm
bashbug70790755editdlrm
bashbug-6470790755editdlrm
batch1400755editdlrm
bcomps239280755editdlrm
bg300755editdlrm
bison5066320755editdlrm
bluemoon448080755editdlrm
bluetoothctl6494560755editdlrm
bond2team232930755editdlrm
bootconfig310160755editdlrm
bootctl1029520755editdlrm
brotli7713760755editdlrm
bsqldb361360755editdlrm
bsqlodbc319360755editdlrm
btattach322720755editdlrm
btmgmt1989040755editdlrm
btmon12436240755editdlrm
bunzip2403920755editdlrm
busctl1025600755editdlrm
bwrap739520755editdlrm
bzcat403920755editdlrm
bzcmp21440755editdlrm
bzdiff21440755editdlrm
bzegrep20580755editdlrm
bzfgrep20580755editdlrm
bzgrep20580755editdlrm
bzip2403920755editdlrm
bzip2recover155920755editdlrm
bzless12630755editdlrm
bzmore12630755editdlrm
c++10972240755editdlrm
c++filt278400755editdlrm
c892280755editdlrm
c992190755editdlrm
ca-legacy16480755editdlrm
cal530640755editdlrm
canberra-boot195280755editdlrm
canberra-gtk-play196400755editdlrm
captoinfo898960755editdlrm
cat363120755editdlrm
catchsegv32890755editdlrm
catman367200755editdlrm
cc10931280755editdlrm
ccomps281280755editdlrm
cd300755editdlrm
centrino-decode144640755editdlrm
certutil1767360755editdlrm
chacl196080755editdlrm
chage737044755editdlrm
chattr155520755editdlrm
chcat139570755editdlrm
chcon614880755editdlrm
checkmodule4617040755editdlrm
checkpolicy5401840755editdlrm
chfn320324711editdlrm
chgrp573200755editdlrm
chmem362480755editdlrm
chmod573040755editdlrm
choom238560755editdlrm
chown614320755editdlrm
chronyc1072560755editdlrm
chrt279600755editdlrm
chsh237840711editdlrm
chvt155440755editdlrm
cifsiostat239200755editdlrm
circo156000755editdlrm
cksum321360755editdlrm
cl-linksafe-apply-group5580755editdlrm
cl-linksafe-reconfigure49470755editdlrm
clear155120755editdlrm
clockdiff237520755editdlrm
cluster488400755editdlrm
cmp410960755editdlrm
cmsutil484960755editdlrm
col237920755editdlrm
colcrt155520755editdlrm
colrm155280755editdlrm
column361840755editdlrm
comm364080755editdlrm
command350755editdlrm
compare154560755editdlrm
compile_et13460755editdlrm
composite154560755editdlrm
config_data71380755editdlrm
conjure154640755editdlrm
convert154640755editdlrm
coredumpctl612800755editdlrm
corelist152790755editdlrm
cp1444000755editdlrm
cpan85710755editdlrm
cpan-mirrors42880755editdlrm
cpansign20320755editdlrm
cpapi134781120755editdlrm
cpapi234781120755editdlrm
cpapi334781120755editdlrm
cpio1490160755editdlrm
cpp10972240755editdlrm
cpupower819360755editdlrm
crb26540744editdlrm
crc3210430755editdlrm
crlutil942000755editdlrm
cronnext407040755editdlrm
crontab571124755editdlrm
csplit1112720755editdlrm
curl2544480755editdlrm
cut446560755editdlrm
cvtsudoers3606800755editdlrm
cxpm280720755editdlrm
cyrusbdb2current16518240755editdlrm
datacopy319920755editdlrm
date1063360755editdlrm
dbus-broker2363680755editdlrm
dbus-broker-launch1319040755editdlrm
dbus-monitor279200755editdlrm
dbus-send278720755editdlrm
dbus-update-activation-environment155360755editdlrm
dbus-uuidgen155040755editdlrm
dbxtool238960755editdlrm
dconf662640755editdlrm
dd695760755editdlrm
deallocvt155520755editdlrm
debuginfo-install36900755editdlrm
debuginfod-find197360755editdlrm
defncopy320160755editdlrm
delv464720755editdlrm
df824640755editdlrm
diff1993680755editdlrm
diff3535600755editdlrm
diffimg156240755editdlrm
dig1398720755editdlrm
dijkstra199040755editdlrm
dir1407520755editdlrm
dircolors405680755editdlrm
dirmngr4505280755editdlrm
dirmngr-client574720755editdlrm
dirname279520755editdlrm
display154560755editdlrm
distro9530755editdlrm
dltest154640755editdlrm
dmesg734960755editdlrm
dnf20940755editdlrm
dnf-320940755editdlrm
dnf420940755editdlrm
dnsdomainname244080755editdlrm
dnstap-read237440755editdlrm
domainname244080755editdlrm
dot156000755editdlrm
dot2gxl408880755editdlrm
dotty20890755editdlrm
doveadm8404640755editdlrm
doveconf3842480755editdlrm
dovecot-sysreport64310755editdlrm
dpkg3282160755editdlrm
dpkg-deb1574000755editdlrm
dpkg-divert1328880755editdlrm
dpkg-maintscript-helper211280755editdlrm
dpkg-query1496720755editdlrm
dpkg-realpath364880755editdlrm
dpkg-split1072720755editdlrm
dpkg-statoverride574000755editdlrm
dpkg-trigger492320755editdlrm
dracut1009170755editdlrm
dtrace177960755editdlrm
du1528480755editdlrm
dumpkeys1678000755editdlrm
dwp8720320755editdlrm
dwz2334640755editdlrm
ea-php81113216640755editdlrm
ea-php81-pear3830755editdlrm
ea-php81-pecl2990755editdlrm
ea-php82114099360755editdlrm
ea-php82-pear3830755editdlrm
ea-php82-pecl2990755editdlrm
ea-wappspector1040755editdlrm
echo279440755editdlrm
ed537680755editdlrm
edgepaint25803040755editdlrm
egrep320755editdlrm
eject446560755editdlrm
elfedit366960755editdlrm
enc2xs416630755editdlrm
encguess29890755editdlrm
env450880755editdlrm
envml42050755editdlrm
envsubst362400755editdlrm
eps2eps6430755editdlrm
eqn1940640755editdlrm
event_rpcgen.py549360755editdlrm
evmctl712640755editdlrm
ex14522560755editdlrm
exempi288560755editdlrm
exiv22046160755editdlrm
expand404880755editdlrm
expr1110400755editdlrm
factor735920755editdlrm
fallocate237600755editdlrm
false279360755editdlrm
fc300755editdlrm
fc-cache1390755editdlrm
fc-cache-64237280755editdlrm
fc-cat196160755editdlrm
fc-conflist154960755editdlrm
fc-list154960755editdlrm
fc-match154960755editdlrm
fc-pattern155040755editdlrm
fc-query154960755editdlrm
fc-scan155040755editdlrm
fc-validate155040755editdlrm
fdp156000755editdlrm
fg300755editdlrm
fgconsole155360755editdlrm
fgrep320755editdlrm
filan487760755editdlrm
file282880755editdlrm
fincore238560755editdlrm
find2917920755editdlrm
find-repos-of-install36900755editdlrm
findmnt663040755editdlrm
fips-finish-install17640755editdlrm
fips-mode-setup82130755editdlrm
firewall-cmd1436080755editdlrm
firewall-offline-cmd1239520755editdlrm
fisql361360755editdlrm
flatpak18585600755editdlrm
flatpak-bisect78440755editdlrm
flatpak-coredumpctl34330755editdlrm
flex4225440755editdlrm
flex++4225440755editdlrm
flock239280755editdlrm
fmt405280755editdlrm
fold404560755editdlrm
free239200755editdlrm
freebcp237440755editdlrm
freetype-config44230755editdlrm
fribidi292720755editdlrm
ftp1030720755editdlrm
funzip320000755editdlrm
fuse2fs744240755editdlrm
fusermount363684755editdlrm
fusermount3364004755editdlrm
fwupdmgr1607840755editdlrm
fwupdtool1814560755editdlrm
g++10972240755editdlrm
g131129360755editdlrm
gapplication237680755editdlrm
gawk7149280755editdlrm
gc198560755editdlrm
gcc10931280755editdlrm
gcc-ar283360755editdlrm
gcc-nm283120755editdlrm
gcc-ranlib283360755editdlrm
gcov4885760755editdlrm
gcov-dump2987680755editdlrm
gcov-tool3281600755editdlrm
gdbmtool1528400755editdlrm
gdbm_dump288960755editdlrm
gdbm_load373520755editdlrm
gdbus527360755editdlrm
gdbus-codegen20380755editdlrm
gdk-pixbuf-query-loaders-64155280755editdlrm
gdk-pixbuf-thumbnailer196080755editdlrm
gencat281040755editdlrm
genl-ctrl-list158480755editdlrm
gen_grub_cfgstub6600700editdlrm
geqn1940640755editdlrm
GET162000755editdlrm
getconf360800755editdlrm
getent367200755editdlrm
getfacl320320755editdlrm
getfattr279200755editdlrm
getkeycodes155280755editdlrm
getopt238240755editdlrm
getopts350755editdlrm
gettext362000755editdlrm
gettext.sh51910755editdlrm
gettextize422360755editdlrm
ghostscript154880755editdlrm
gio940240755editdlrm
gio-querymodules-64154960755editdlrm
git233775200755editdlrm
git-receive-pack233775200755editdlrm
git-shell65629840755editdlrm
git-upload-archive233775200755editdlrm
git-upload-pack233775200755editdlrm
glib-compile-resources443840755editdlrm
glib-compile-schemas527040755editdlrm
glib-genmarshal411050755editdlrm
glib-gettextize53900755editdlrm
glib-mkenums307970755editdlrm
gmake2557920755editdlrm
gml2gv489280755editdlrm
gneqn9160755editdlrm
gnroff32850755editdlrm
gobject-query155280755editdlrm
gpasswd780164755editdlrm
gpg11236240755editdlrm
gpg-agent3504880755editdlrm
gpg-card1742160755editdlrm
gpg-connect-agent867840755editdlrm
gpg-error369680755editdlrm
gpg-error-config20240755editdlrm
gpg-wks-client1326560755editdlrm
gpg-wks-server1160480755editdlrm
gpg211236240755editdlrm
gpgconf1034080755editdlrm
gpgme-json866560755editdlrm
gpgparsemail361760755editdlrm
gpgrt-config134500755editdlrm
gpgsplit281600755editdlrm
gpgtar664240755editdlrm
gpgv3025200755editdlrm
gpgv23025200755editdlrm
gpic2065600755editdlrm
gpio-event-mon185600755editdlrm
gpio-hammer144560755editdlrm
gpio-watch144560755editdlrm
gprof1039200755editdlrm
gr2fonttest286720755editdlrm
graphml2gv241120755editdlrm
grep1582000755editdlrm
gresource238400755editdlrm
groff990880755editdlrm
grops1712720755editdlrm
grotty1251280755editdlrm
groups363280755editdlrm
grub2-editenv4984160755editdlrm
grub2-file11633040755editdlrm
grub2-fstest17505920755editdlrm
grub2-glue-efi3085760755editdlrm
grub2-kbdcomp16720755editdlrm
grub2-menulst2cfg2913440755editdlrm
grub2-mkfont3420400755editdlrm
grub2-mkimage4768160755editdlrm
grub2-mklayout3189200755editdlrm
grub2-mknetdir5453760755editdlrm
grub2-mkpasswd-pbkdf23215440755editdlrm
grub2-mkrelpath3083920755editdlrm
grub2-mkrescue14081680755editdlrm
grub2-mkstandalone6522480755editdlrm
grub2-mount10738000755editdlrm
grub2-render-label11682400755editdlrm
grub2-script-check3419600755editdlrm
grub2-syslinux2cfg10949920755editdlrm
gs154880755editdlrm
gsbj3540755editdlrm
gsdj3560755editdlrm
gsdj5003560755editdlrm
gsettings321360755editdlrm
gsf-office-thumbnailer205520755editdlrm
gslj3570755editdlrm
gslp3540755editdlrm
gsnd2810755editdlrm
gsoelim329520755editdlrm
gst-inspect-1.0734720755editdlrm
gst-launch-1.0404240755editdlrm
gst-stats-1.0364960755editdlrm
gst-typefind-1.0198000755editdlrm
gtar5348240755editdlrm
gtbl1340000755editdlrm
gtester320400755editdlrm
gtester-report190900755editdlrm
gtk-launch197440755editdlrm
gtk-query-immodules-2.0-64196320755editdlrm
gtk-query-immodules-3.0-64238320755editdlrm
gtk-update-icon-cache407840755editdlrm
gtroff7496400755editdlrm
gunzip23500755editdlrm
gv2gml239680755editdlrm
gv2gxl408880755editdlrm
gvcolor507760755editdlrm
gvgen239760755editdlrm
gvmap28810960755editdlrm
gvmap.sh21940755editdlrm
gvpack4076960755editdlrm
gvpr155680755editdlrm
gxl2dot408880755editdlrm
gxl2gv408880755editdlrm
gzexe64840755editdlrm
gzip910880755editdlrm
h2ph293820755editdlrm
h2xs609310755editdlrm
hardlink362800755editdlrm
hash320755editdlrm
hb-ot-shape-closure447040755editdlrm
hb-shape490560755editdlrm
hb-subset406080755editdlrm
hb-view655440755editdlrm
HEAD162000755editdlrm
head405600755editdlrm
hex2hcd195360755editdlrm
hexdump526400755editdlrm
host1111760755editdlrm
hostid322240755editdlrm
hostname244080755editdlrm
hostnamectl322480755editdlrm
htdbm394560755editdlrm
htdigest263280755editdlrm
html2text9800755editdlrm
htpasswd395840755editdlrm
httxt2dbm253200755editdlrm
hunspell1051360755editdlrm
i386281360755editdlrm
ibd2sdi3339760755editdlrm
iconv656240755editdlrm
icu-config2050755editdlrm
icu-config-64221890755editdlrm
icuinfo158640755editdlrm
id404720755editdlrm
identify154640755editdlrm
idiag-socket-details158880755editdlrm
idn373360755editdlrm
ifnames41280755editdlrm
iio_event_monitor308560755editdlrm
iio_generic_buffer349600755editdlrm
ima-add-sigs37630755editdlrm
ima-setup38000755editdlrm
import154560755editdlrm
imunify-agent-proxy137820080755editdlrm
imunify-antivirus10240755editdlrm
imunify-fgw-dump81829920755editdlrm
imunify-service10200755editdlrm
imunify360-agent10240755editdlrm
imunify360-command-wrapper122100755editdlrm
info3202400755editdlrm
infocmp652080755editdlrm
infotocap898960755editdlrm
innochecksum2346960755editdlrm
install1526560755editdlrm
instmodsh41940755editdlrm
intel-speed-select1194640755editdlrm
ionice155760755editdlrm
iostat570320755editdlrm
ipcmk238480755editdlrm
ipcrm196880755editdlrm
ipcs402800755editdlrm
iptc300080755editdlrm
irqtop361200755editdlrm
isosize155120755editdlrm
ispell9920755editdlrm
isql402880755editdlrm
iusql320560755editdlrm
jcat-tool452720755editdlrm
jobs320755editdlrm
join529280755editdlrm
journalctl902240755editdlrm
jq319280755editdlrm
json_pp48960755editdlrm
json_reformat199840755editdlrm
json_verify156720755editdlrm
json_xs70130755editdlrm
kbdinfo196560755editdlrm
kbdrate196640755editdlrm
kbd_mode158800755editdlrm
kdumpctl612760755editdlrm
kernel-install140300755editdlrm
keyctl655600755editdlrm
kill320320755editdlrm
killall337360755editdlrm
kmod1695440755editdlrm
krb5-config67460755editdlrm
kvm_stat644270755editdlrm
l2ping155440755editdlrm
last361360755editdlrm
lastb361360755editdlrm
lastlog293200755editdlrm
lchfn236800755editdlrm
lchsh236800755editdlrm
ld17916000755editdlrm
ld.bfd17916000755editdlrm
ld.gold21285920755editdlrm
ld.so9387920755editdlrm
ldd54460755editdlrm
lefty3076560755editdlrm
less2024400755editdlrm
lessecho155360755editdlrm
lesskey252000755editdlrm
lesspipe.sh35800755editdlrm
lex4225440755editdlrm
lexgrog903040755editdlrm
libnetcfg157750755editdlrm
libpng-config24400755editdlrm
libpng16-config24400755editdlrm
libtool3678020755editdlrm
libtoolize1292000755editdlrm
libwmf-fontmap133440755editdlrm
link322320755editdlrm
linux-boot-prober59970755editdlrm
linux32281360755editdlrm
linux64281360755editdlrm
ln572880755editdlrm
lneato15510755editdlrm
loadkeys2051760755editdlrm
loadunimap321840755editdlrm
locale604960755editdlrm
localectl322000755editdlrm
localedef3215840755editdlrm
logger368400755editdlrm
login445040755editdlrm
loginctl695920755editdlrm
logname322240755editdlrm
logresolve256640755editdlrm
look196320755editdlrm
ls1407440755editdlrm
lsattr155440755editdlrm
lsblk1273520755editdlrm
lscpu1108320755editdlrm
lsgpio146400755editdlrm
lsiio226720755editdlrm
lsinitrd121370755editdlrm
lsipc527360755editdlrm
lsirq237920755editdlrm
lslocks323520755editdlrm
lslogins527360755editdlrm
lsmem363760755editdlrm
lsns402720755editdlrm
lsof1792640755editdlrm
lsphp9370755editdlrm
lsscsi915840755editdlrm
lto-dump278825680755editdlrm
lua237840755editdlrm
luac1614720755editdlrm
lwp-download102920755editdlrm
lwp-dump27110755editdlrm
lwp-mirror24130755editdlrm
lwp-request162000755editdlrm
lynis524540755editdlrm
lz4_decompress1303120755editdlrm
m42461680755editdlrm
Mail10375680755editdlrm
mail10375680755editdlrm
mailx10375680755editdlrm
mailx.s-nail10375680755editdlrm
make2557920755editdlrm
make-dummy-cert6140755editdlrm
man1176720755editdlrm
man-recode286800755editdlrm
man.man-db1176720755editdlrm
mandb1362000755editdlrm
manpath325840755editdlrm
mapscrn321440755editdlrm
mcookie279600755editdlrm
md5sum403920755editdlrm
mdb_copy160800755editdlrm
mdb_dump162160755editdlrm
mdb_load244080755editdlrm
mdb_stat161840755editdlrm
mdig525360755editdlrm
mesg155040755editdlrm
mkdir697600755editdlrm
mkfifo405920755editdlrm
mkfontdir690755editdlrm
mkfontscale458480755editdlrm
mknod447280755editdlrm
mktemp405680755editdlrm
mm2gv403920755editdlrm
mmdblookup283840755editdlrm
modulecmd6697020755editdlrm
modulemd-validator290720755editdlrm
modutil941120755editdlrm
mogrify154640755editdlrm
mokutil626880755editdlrm
montage154640755editdlrm
more444640755editdlrm
mount484804755editdlrm
mountpoint196400755editdlrm
mpris-proxy1035840755editdlrm
mpstat528320755editdlrm
msgattrib278240755editdlrm
msgcat277920755editdlrm
msgcmp279200755editdlrm
msgcomm278080755editdlrm
msgconv237040755editdlrm
msgen237040755editdlrm
msgexec237040755editdlrm
msgfilter361600755editdlrm
msgfmt861120755editdlrm
msgfmt.py75900755editdlrm
msgfmt3.9.py75900755editdlrm
msgfmt3.py75900755editdlrm
msggrep1192000755editdlrm
msginit690560755editdlrm
msgmerge772960755editdlrm
msgunfmt361760755editdlrm
msguniq237040755editdlrm
mv1443280755editdlrm
myisamchk67999760755editdlrm
myisamlog66312000755editdlrm
myisampack66667840755editdlrm
myisam_ftdump66066240755editdlrm
mysql74960640755editdlrm
mysqladmin72301680755editdlrm
mysqlbinlog75416320755editdlrm
mysqlcheck72389680755editdlrm
mysqldump73035120755editdlrm
mysqldumpslow77190755editdlrm
mysqld_pre_systemd44210755editdlrm
mysqlimport72181520755editdlrm
mysqlpump77066640755editdlrm
mysqlshow72167280755editdlrm
mysqlslap72278800755editdlrm
mysql_config8430755editdlrm
mysql_config-6450520755editdlrm
mysql_config_editor2196080755editdlrm
mysql_migrate_keyring72921040755editdlrm
mysql_secure_installation72018000755editdlrm
mysql_ssl_rsa_setup2644960755editdlrm
mysql_tzinfo_to_sql1420480755editdlrm
mysql_upgrade73006240755editdlrm
my_print_defaults2303840755editdlrm
nail10375680755editdlrm
named-rrchecker236960755editdlrm
namei237840755editdlrm
nano3545040755editdlrm
nc531040755editdlrm
ncurses6-config83210755editdlrm
ncursesw6-config83240755editdlrm
ndptool280800755editdlrm
neato156000755editdlrm
needs-restarting36900755editdlrm
neqn9160755editdlrm
netcat531040755editdlrm
netstat1606160755editdlrm
newgidmap429600755editdlrm
newgrp417444755editdlrm
newuidmap388400755editdlrm
nf-ct-add162720755editdlrm
nf-ct-events156960755editdlrm
nf-ct-list163120755editdlrm
nf-exp-add207920755editdlrm
nf-exp-delete164720755editdlrm
nf-exp-list163120755editdlrm
nf-log156800755editdlrm
nf-monitor156960755editdlrm
nf-queue156880755editdlrm
ngettext361920755editdlrm
nice363360755editdlrm
nisdomainname244080755editdlrm
nl1029200755editdlrm
nl-addr-add161440755editdlrm
nl-addr-delete162000755editdlrm
nl-addr-list203120755editdlrm
nl-class-add161280755editdlrm
nl-class-delete160400755editdlrm
nl-class-list160080755editdlrm
nl-classid-lookup158720755editdlrm
nl-cls-add202880755editdlrm
nl-cls-delete161120755editdlrm
nl-cls-list160640755editdlrm
nl-fib-lookup158960755editdlrm
nl-link-enslave156560755editdlrm
nl-link-ifindex2name156560755editdlrm
nl-link-list160480755editdlrm
nl-link-name2ifindex156560755editdlrm
nl-link-release156560755editdlrm
nl-link-set161200755editdlrm
nl-link-stats159040755editdlrm
nl-list-caches156720755editdlrm
nl-list-sockets156560755editdlrm
nl-monitor158560755editdlrm
nl-neigh-add160400755editdlrm
nl-neigh-delete160720755editdlrm
nl-neigh-list159840755editdlrm
nl-neightbl-list158160755editdlrm
nl-nh-list158480755editdlrm
nl-pktloc-lookup159040755editdlrm
nl-qdisc-add160720755editdlrm
nl-qdisc-delete160400755editdlrm
nl-qdisc-list201600755editdlrm
nl-route-add203120755editdlrm
nl-route-delete203920755editdlrm
nl-route-get156800755editdlrm
nl-route-list162400755editdlrm
nl-rule-list158480755editdlrm
nl-tctree-list159760755editdlrm
nl-util-addr156560755editdlrm
nm457920755editdlrm
nm-online239440755editdlrm
nmcli10796720755editdlrm
nmtui8626560755editdlrm
nmtui-connect8626560755editdlrm
nmtui-edit8626560755editdlrm
nmtui-hostname8626560755editdlrm
nohup362480755editdlrm
nop156960755editdlrm
notify-send202240755editdlrm
nproc363520755editdlrm
nroff32850755editdlrm
nsenter281280755editdlrm
nslookup1152240755editdlrm
nss-policy-check155200755editdlrm
nsupdate735280755editdlrm
numfmt569680755editdlrm
objcopy1898160755editdlrm
objdump4230000755editdlrm
od654080755editdlrm
odbcinst237280755editdlrm
odbc_config154720755editdlrm
openssl11225520755editdlrm
openvt241200755editdlrm
orc-bugreport238720755editdlrm
os-prober59190755editdlrm
osage156000755editdlrm
osinfo-db-export280080755editdlrm
osinfo-db-import279600755editdlrm
osinfo-db-path156720755editdlrm
osinfo-db-validate239600755editdlrm
osinfo-detect280560755editdlrm
osinfo-install-script325360755editdlrm
osinfo-query329600755editdlrm
osql97070755editdlrm
p11-kit2459040755editdlrm
pacat526560755editdlrm
package-cleanup36900755editdlrm
pacmd195840755editdlrm
pactl815840755editdlrm
page_owner_sort267520755editdlrm
pamon526560755editdlrm
pango-list195680755editdlrm
pango-segmentation195840755editdlrm
pango-view616160755editdlrm
paperconf161840755editdlrm
paplay526560755editdlrm
parec526560755editdlrm
parecord526560755editdlrm
passwd326564755editdlrm
paste362400755editdlrm
pasuspender238320755editdlrm
patch1996960755editdlrm
patchwork156000755editdlrm
pathchk363280755editdlrm
pathfix.py67860755editdlrm
pathfix3.9.py67860755editdlrm
pax11publish154880755editdlrm
pcre-config21420755editdlrm
pcre2-config19540755editdlrm
pdf2dsc7010755editdlrm
pdf2ps9130755editdlrm
pdnsutil50501760755editdlrm
pdns_control4915440755editdlrm
peekfd161840755editdlrm
perl154960755editdlrm
perl5.32.1154960755editdlrm
perlbug448630755editdlrm
perldoc1180755editdlrm
perlivp108130755editdlrm
perlml148400755editdlrm
perlthanks448630755editdlrm
perror10309280755editdlrm
pf2afm5020755editdlrm
pfbtopfa5200755editdlrm
pftp1030720755editdlrm
pgrep321760755editdlrm
php9370755editdlrm
pic2065600755editdlrm
piconv82710755editdlrm
pidof238880755editdlrm
pidstat528320755editdlrm
pidwait321760755editdlrm
pigz1360240755editdlrm
ping914720755editdlrm
pinky362640755editdlrm
pip6480755editdlrm
pip-36480755editdlrm
pip-3.96480755editdlrm
pip36480755editdlrm
pip3.96480755editdlrm
pipewire155200755editdlrm
pipewire-aes67155200755editdlrm
pipewire-avb155200755editdlrm
pipewire-pulse155200755editdlrm
pipewire-vulkan155200755editdlrm
pk12util741920755editdlrm
pkaction196240755editdlrm
pkcheck237280755editdlrm
pkexec319284755editdlrm
pkg-config3350755editdlrm
pkgconf464480755editdlrm
pkill321760755editdlrm
pkla-admin-identities245360755editdlrm
pkla-check-authorization369680755editdlrm
pkttyagent237120755editdlrm
pl2pm45330755editdlrm
pldd239280755editdlrm
plesk_configure3460755editdlrm
pmap362400755editdlrm
png-fix-itxt154720755editdlrm
pngfix609920755editdlrm
pod2html41340755editdlrm
pod2man150340755editdlrm
pod2text108030755editdlrm
pod2usage41070755editdlrm
podchecker36580755editdlrm
POST162000755editdlrm
post-grohtml2045520755editdlrm
powernow-k8-decode144640755editdlrm
pphs4080755editdlrm
pr738320755editdlrm
pre-grohtml951520755editdlrm
precat56600755editdlrm
preconv576160755editdlrm
preunzip56600755editdlrm
prezip56600755editdlrm
prezip-bin160640755editdlrm
printafm3990755editdlrm
printenv320400755editdlrm
printf528160755editdlrm
prlimit284160755editdlrm
procan362800755editdlrm
protoc238800755editdlrm
protoc-c1619920755editdlrm
protoc-gen-c1619920755editdlrm
prove135620755editdlrm
prtstat244160755editdlrm
prune157760755editdlrm
ps1445360755editdlrm
ps2ascii6350755editdlrm
ps2epsi12680755editdlrm
ps2pdf2760755editdlrm
ps2pdf122190755editdlrm
ps2pdf132190755editdlrm
ps2pdf142190755editdlrm
ps2pdfwr10820755editdlrm
ps2ps6510755editdlrm
ps2ps26730755editdlrm
psfaddtable320080755editdlrm
psfgettable320080755editdlrm
psfstriptable320080755editdlrm
psfxtable320080755editdlrm
pslog160800755editdlrm
pstree377840755editdlrm
pstree.x11377840755editdlrm
ptar34700755editdlrm
ptardiff25490755editdlrm
ptargrep42990755editdlrm
ptx1319120755editdlrm
pure-pw395120755editdlrm
pure-pwconvert148640755editdlrm
pure-statsdecode148640755editdlrm
pw-jack13520755editdlrm
pwd363760755editdlrm
pwdx156480755editdlrm
pwmake160800755editdlrm
pwscore160800755editdlrm
pydoc780755editdlrm
pydoc3780755editdlrm
pydoc3.9780755editdlrm
pygettext.py215370755editdlrm
pygettext3.9.py215370755editdlrm
pygettext3.py215370755editdlrm
python-config610755editdlrm
python-html2text9800755editdlrm
python3154480755editdlrm
python3-config610755editdlrm
python3-html2text9800755editdlrm
python3.9154480755editdlrm
python3.9-config610755editdlrm
python3.9-x86_64-config36240755editdlrm
quota836324755editdlrm
quotasync664320755editdlrm
ranlib573360755editdlrm
read320755editdlrm
readelf6832960755editdlrm
readlink404560755editdlrm
realpath405360755editdlrm
recode-sr-latin154960755editdlrm
red920755editdlrm
rename237840755editdlrm
renew-dummy-cert7290755editdlrm
renice155280755editdlrm
repo-graph36900755editdlrm
repoclosure36900755editdlrm
repodiff36900755editdlrm
repomanage36900755editdlrm
repoquery36900755editdlrm
reposync36900755editdlrm
repotrack36900755editdlrm
rescan-scsi-bus.sh390020755editdlrm
reset279920755editdlrm
resizecons280320755editdlrm
rev155200755editdlrm
rm614320755editdlrm
rmdir444640755editdlrm
rnano3545040755editdlrm
rpcbind613280755editdlrm
rpcinfo364320755editdlrm
rpm242000755editdlrm
rpm2archive238800755editdlrm
rpm2cpio154800755editdlrm
rpmdb202160755editdlrm
rpmkeys159680755editdlrm
rpmquery242000755editdlrm
rpmverify242000755editdlrm
rsync5885680755editdlrm
rsync-ssl51320755editdlrm
run-parts19870755editdlrm
run-with-aspell890755editdlrm
runcon363120755editdlrm
rvi14522560755editdlrm
rview14522560755editdlrm
s-nail10375680755editdlrm
sadf4698560755editdlrm
sar1389280755editdlrm
sccmap239280755editdlrm
scl404960755editdlrm
scl_enabled2620755editdlrm
scl_source19290755editdlrm
scp1361040755editdlrm
script528160755editdlrm
scriptlive445200755editdlrm
scriptreplay361440755editdlrm
scsi-rescan390020755editdlrm
scsi_logging_level85880755editdlrm
scsi_mandat36060755editdlrm
scsi_readcap13310755editdlrm
scsi_ready11250755editdlrm
scsi_satl38340755editdlrm
scsi_start12890755editdlrm
scsi_stop14780755editdlrm
scsi_temperature9400755editdlrm
sdiff452640755editdlrm
secon289280755editdlrm
sed1155440755editdlrm
sedismod2959520755editdlrm
sedispol2252080755editdlrm
semodule_expand154800755editdlrm
semodule_link154960755editdlrm
semodule_package196240755editdlrm
semodule_unpackage154880755editdlrm
seq487360755editdlrm
sestatus236800755editdlrm
setarch281360755editdlrm
setfacl444160755editdlrm
setfattr278640755editdlrm
setfont528800755editdlrm
setkeycodes155680755editdlrm
setleds197360755editdlrm
setmetamode156720755editdlrm
setpriv402880755editdlrm
setsid155120755editdlrm
setterm361760755editdlrm
setup-nsssysinit15430755editdlrm
setup-nsssysinit.sh15430755editdlrm
setvtrgb156320755editdlrm
sfdp156000755editdlrm
sftp1608640755editdlrm
sg417444755editdlrm
sginfo753600755editdlrm
sgm_dd402880755editdlrm
sgp_dd445920755editdlrm
sg_bg_ctl157120755editdlrm
sg_compare_and_write284320755editdlrm
sg_copy_results246480755editdlrm
sg_dd567120755editdlrm
sg_decode_sense160400755editdlrm
sg_emc_trespass154960755editdlrm
sg_format412000755editdlrm
sg_get_config370400755editdlrm
sg_get_elem_status283040755editdlrm
sg_get_lba_status243760755editdlrm
sg_ident158000755editdlrm
sg_inq1236000755editdlrm
sg_logs1565680755editdlrm
sg_luns242320755editdlrm
sg_map196480755editdlrm
sg_map26283200755editdlrm
sg_modes481200755editdlrm
sg_opcodes368160755editdlrm
sg_persist378160755editdlrm
sg_prevent156960755editdlrm
sg_raw284240755editdlrm
sg_rbuf241760755editdlrm
sg_rdac154800755editdlrm
sg_read278480755editdlrm
sg_readcap242240755editdlrm
sg_read_attr384240755editdlrm
sg_read_block_limits157440755editdlrm
sg_read_buffer290320755editdlrm
sg_read_long159120755editdlrm
sg_reassign158640755editdlrm
sg_referrals158800755editdlrm
sg_rep_pip157840755editdlrm
sg_rep_zones285040755editdlrm
sg_requests241680755editdlrm
sg_reset158960755editdlrm
sg_reset_wp158160755editdlrm
sg_rmsn157040755editdlrm
sg_rtpg158080755editdlrm
sg_safte241120755editdlrm
sg_sanitize285280755editdlrm
sg_sat_identify200560755editdlrm
sg_sat_phy_event203360755editdlrm
sg_sat_read_gplog200400755editdlrm
sg_sat_set_features200000755editdlrm
sg_scan196480755editdlrm
sg_seek202080755editdlrm
sg_senddiag287680755editdlrm
sg_ses1239600755editdlrm
sg_ses_microcode289280755editdlrm
sg_start201920755editdlrm
sg_stpg241200755editdlrm
sg_stream_ctl200160755editdlrm
sg_sync158800755editdlrm
sg_test_rwbuf199840755editdlrm
sg_timestamp242000755editdlrm
sg_turs282800755editdlrm
sg_unmap241920755editdlrm
sg_verify202240755editdlrm
sg_vpd1223600755editdlrm
sg_write_buffer287680755editdlrm
sg_write_long159680755editdlrm
sg_write_same284880755editdlrm
sg_write_verify283200755editdlrm
sg_write_x620320755editdlrm
sg_wr_mode241200755editdlrm
sg_xcopy444080755editdlrm
sg_zone201120755editdlrm
sh13890240755editdlrm
sha1hmac361120755editdlrm
sha1sum403920755editdlrm
sha224hmac361120755editdlrm
sha224sum403920755editdlrm
sha256hmac361120755editdlrm
sha256sum403920755editdlrm
sha384hmac361120755editdlrm
sha384sum403920755editdlrm
sha512hmac361120755editdlrm
sha512sum403920755editdlrm
shasum98920755editdlrm
showconsolefont197520755editdlrm
showkey196880755editdlrm
shred529200755editdlrm
shuf489520755editdlrm
sieve-dump387920755editdlrm
sieve-filter443840755editdlrm
sieve-test443120755editdlrm
sievec390480755editdlrm
signver405520755editdlrm
size323680755editdlrm
skill321520755editdlrm
slabinfo439840755editdlrm
slabtop239840755editdlrm
sleep322240755editdlrm
slencheck154880755editdlrm
sm3hmac361120755editdlrm
snice321520755editdlrm
socat3962080755editdlrm
soelim329520755editdlrm
soelim.groff329520755editdlrm
sort1156080755editdlrm
sotruss42820755editdlrm
spell1250755editdlrm
splain194110755editdlrm
split533600755editdlrm
sprof362960755editdlrm
sqlite316102240755editdlrm
ssh9178960755editdlrm
ssh-add3130560755editdlrm
ssh-agent3253280755editdlrm
ssh-copy-id141740755editdlrm
ssh-keygen4868240755editdlrm
ssh-keyscan3463520755editdlrm
ssltap732560755editdlrm
sss_ssh_authorizedkeys238480755editdlrm
sss_ssh_knownhostsproxy279520755editdlrm
stat817680755editdlrm
stdbuf446000755editdlrm
strace21766640755editdlrm
strace-log-merge18790755editdlrm
stream154560755editdlrm
streamzip78450755editdlrm
strings325040755editdlrm
strip1898080755editdlrm
stty774560755editdlrm
su569364750editdlrm
sudo2976884111editdlrm
sudoedit2976884111editdlrm
sudoreplay998880111editdlrm
sum362320755editdlrm
sw-engine253140960755editdlrm
sxpm323360755editdlrm
sync362000755editdlrm
systemctl3055760755editdlrm
systemd-analyze2064160755editdlrm
systemd-ask-password199280755editdlrm
systemd-cat197280755editdlrm
systemd-cgls240320755editdlrm
systemd-cgtop403600755editdlrm
systemd-creds448560755editdlrm
systemd-cryptenroll738080755editdlrm
systemd-delta279680755editdlrm
systemd-detect-virt197200755editdlrm
systemd-dissect489280755editdlrm
systemd-escape238160755editdlrm
systemd-firstboot574320755editdlrm
systemd-hwdb156480755editdlrm
systemd-id128280320755editdlrm
systemd-inhibit238720755editdlrm
systemd-machine-id-setup200160755editdlrm
systemd-mount614720755editdlrm
systemd-notify238720755editdlrm
systemd-path197200755editdlrm
systemd-repart1733280755editdlrm
systemd-run655600755editdlrm
systemd-socket-activate280080755editdlrm
systemd-stdio-bridge238240755editdlrm
systemd-sysext489040755editdlrm
systemd-sysusers740880755editdlrm
systemd-tmpfiles1275280755editdlrm
systemd-tty-ask-password-agent403120755editdlrm
systemd-umount614720755editdlrm
tabs196240755editdlrm
tac1028080755editdlrm
tail695360755editdlrm
tapestat280240755editdlrm
tar5348240755editdlrm
taskset237840755editdlrm
tbl1340000755editdlrm
tclsh160640755editdlrm
tclsh8.6160640755editdlrm
tcptraceroute15890755editdlrm
tdspool2640480755editdlrm
team2bond161380755editdlrm
teamd1705920755editdlrm
teamdctl380080755editdlrm
teamnl238160755editdlrm
tee363440755editdlrm
test446640755editdlrm
tic898960755editdlrm
timedatectl488080755editdlrm
timeout368480755editdlrm
tload198000755editdlrm
tmon435040755editdlrm
tmpwatch368960755editdlrm
toe237840755editdlrm
top1354480755editdlrm
touch940480755editdlrm
tput279040755editdlrm
tr447280755editdlrm
tracepath196800755editdlrm
traceroute791440755editdlrm
traceroute6791440755editdlrm
tracker36257440755editdlrm
tred157200755editdlrm
troff7496400755editdlrm
true279360755editdlrm
truncate363280755editdlrm
trust2753360755editdlrm
tset279920755editdlrm
tsort487440755editdlrm
tsql2598400755editdlrm
tty322240755editdlrm
turbostat1726080755editdlrm
twopi156000755editdlrm
type320755editdlrm
tzselect153520755editdlrm
uapi34781120755editdlrm
udevadm6019600755editdlrm
ul238160755editdlrm
ulimit340755editdlrm
ulockmgr_server198400755editdlrm
umask330755editdlrm
umount361124755editdlrm
unalias350755editdlrm
uname322320755editdlrm
uname26281360755editdlrm
unexpand404800755editdlrm
unflatten157360755editdlrm
unicode_start26330755editdlrm
unicode_stop3670755editdlrm
uniq446800755editdlrm
unlink322240755editdlrm
unpigz1360240755editdlrm
unshare323120755editdlrm
unxz869760755editdlrm
unzip2006880755editdlrm
unzipsfx898080755editdlrm
update-ca-trust44660755editdlrm
update-crypto-policies870755editdlrm
update-gtk-immodules3160755editdlrm
update-mime-database613040755editdlrm
upower244480755editdlrm
uptime156560755editdlrm
users322560755editdlrm
usleep156560755editdlrm
utmpdump237680755editdlrm
uuidgen196160755editdlrm
uuidparse237680755editdlrm
vdir1407520755editdlrm
VGAuthService1357120755editdlrm
vi14522560755editdlrm
view1460755editdlrm
vimdot10860755editdlrm
vlock240160755editdlrm
vm-support128790755editdlrm
vmhgfs-fuse493600755editdlrm
vmstat403600755editdlrm
vmtoolsd821920755editdlrm
vmware-alias-import870160755editdlrm
vmware-checkvm155680755editdlrm
vmware-hgfsclient156400755editdlrm
vmware-namespace-cmd237760755editdlrm
vmware-rpctool198400755editdlrm
vmware-toolbox-cmd612880755editdlrm
vmware-vgauth-cmd196320755editdlrm
vmware-xferlogs342400755editdlrm
w239280755editdlrm
wait320755editdlrm
wall237840755editdlrm
watch285360755editdlrm
watchgnupg237600755editdlrm
wc445760755editdlrm
wdctl320800755editdlrm
wget5337200755editdlrm
whatis496880755editdlrm
whatis.man-db496880755editdlrm
whereis326080755editdlrm
which285600755editdlrm
whiptail326960755editdlrm
who528320755editdlrm
whoami322240755editdlrm
wireplumber241920755editdlrm
wmf2eps201920755editdlrm
wmf2fig202880755editdlrm
wmf2gd161920755editdlrm
wmf2svg202960755editdlrm
wmf2x160800755editdlrm
word-list-compress160800755editdlrm
wpctl737600755editdlrm
wpexec200720755editdlrm
write238002755editdlrm
x86_64281360755editdlrm
x86_64-redhat-linux-c++10972240755editdlrm
x86_64-redhat-linux-g++10972240755editdlrm
x86_64-redhat-linux-gcc10931280755editdlrm
x86_64-redhat-linux-gcc-1110931280755editdlrm
x86_64-redhat-linux-gnu-pkg-config8290755editdlrm
x86_energy_perf_policy396560755editdlrm
xargs656320755editdlrm
xb-tool322240755editdlrm
xdg-dbus-proxy578960755editdlrm
xgettext3038240755editdlrm
xml2-config18770755editdlrm
xmlcatalog237120755editdlrm
xmllint824880755editdlrm
xmlsec1730880755editdlrm
xmlwf405760755editdlrm
xslt-config26390755editdlrm
xsltproc319840755editdlrm
xsubpp50800755editdlrm
xz869760755editdlrm
xzcat869760755editdlrm
xzcmp66370755editdlrm
xzdec162320755editdlrm
xzdiff66370755editdlrm
xzegrep59080755editdlrm
xzfgrep59080755editdlrm
xzgrep59080755editdlrm
xzless18030755editdlrm
xzmore21660755editdlrm
yat2m410000755editdlrm
yes320640755editdlrm
ypdomainname244080755editdlrm
yum20940755editdlrm
yum-builddep36900755editdlrm
yum-config-manager36900755editdlrm
yum-debug-dump36900755editdlrm
yum-debug-restore36900755editdlrm
yum-groups-manager36900755editdlrm
yumdownloader36900755editdlrm
zcat19880755editdlrm
zcmp16820755editdlrm
zdiff64510755editdlrm
zdump280000755editdlrm
zegrep330755editdlrm
zfgrep330755editdlrm
zforce20850755editdlrm
zgrep81160755editdlrm
zip2264000755editdlrm
zipcloak775120755editdlrm
zipdetails599690755editdlrm
zipgrep29570755editdlrm
zipinfo2006880755editdlrm
zipnote692320755editdlrm
zipsplit651040755editdlrm
zless22100755editdlrm
zlib_decompress1178800755editdlrm
zmore18460755editdlrm
znew45810755editdlrm
zone2json14109280755editdlrm
zone2sql14355360755editdlrm
zsoelim329520755editdlrm
[528720755editdlrm
Edit: /usr/bin/openssl (1122552B)
ELF>@x@8 @@@@88   l2l2pKp[p[вGWW88800hhhDDStd88800PtdTTQtdRtdpKp[p[44/lib64/ld-linux-x86-64.so.2 GNUGNUp S003yGNU )fUa9[;.^e/N[]B,H(h~'G?<>W^k;PV!EPf%E|TjR]xs%z=d_MH E i]GShpoDtI#r 220\Q#gMQWAt 2;$3 6/+oCY)Ggae.` kV;,2!x47iD;QDyUwNE'#/P )R5mS9QJB]l&`GR=|XgC K{T;IWHIo "Fw5v7@0?NY(^ (ZsuUN Q4Et z!BJd3a݄sPcZO }jy*:Z)\4R|k&CL$t tT]/7J2 k@1[s))9& z%;N5adT`jh~zNSn{g@PuYUaKztImps3ExL k"I 2l<1E-a5+ 94@]*4L  R9m;_3_?gS& r8U !Blf-}}4!GQ#|V$$>,yTzMP 1oTgUiU z08S~KpZ=d#yPHx\kq_m4IM[4Iy<R=a)L&(F")h-lS"@244j 4Uqw*MCjI,| B@]rKXrrr;&khWFM&ay/ sk(F}.SR<9Ah/o z9?;ab"WBX> iI_B,b5ZxBI4\bU=/7q^jD@A@9`67x[qi5w.,]+H1tnHVC8SuVM` Tk{i ~%W.9T@}^j*& IA#p4 ^>01Qj"&}U>g'S?(G!DTs8^nt8! f.([{m 3 G[Limg?_C0>$#4Y~y 48-y@<0W/=y[nEkR"ISG"{i(7OW,U/0+g gJcJEIcBdQZdf-%]2BfL_|I~!U)#<[)-AKr sv N| T_' >D84I" 6F O+Wt1x$wgq&<~pGlA U$DVJ5>#MJ2@]J#CΆc6 jHJ:wi?rE/IBa<V\w13-y);8xg_xJUtzNBs!FrxT{сA[_w\<5P.F#yCOvdjj$N^9]HqZS& z[@HX-e/3 feB,U<a^Gi2\z } 92 ^=6*z#"UC*- { k\ PW:3;J 3N-GQY|f@|M"iq4F3Zp'f:vx JSiG ITa-ld_Rdăr)(bul  J pc1m6!|JX4: #!h}G)VPmr>L ?J0$Pwn]R,n5Y!wgL_9KkNt?i  %j+~Z]`yL0iKSf^wFgށ3Fw_eEgE`+b(Fd#>/R9Qe3Z)qOw3eXmJ^0SwOFZR^^;kHMTL u}LN@ob\am].Qr f>.] 95 QA~,EKPp_!KB\ig#D[ i7eXm2A+Hj{Y2"C!fKq6f tO ,PH (KvmBFn7o2waB5hY3AQ2k  ZAGa6*Me mB$: lli:Oa=P$ W.wP 3q Vk UL/ _iVAeam&c/)Yiy]`DwU6&syvr88_OCSK,>A=LXYu}V08P~`7o2cqY{~y{nu{$ \UH.bMC qSebAlyQZcB*/JBy"a1mSmEm3y #ix rW86R7Tu?GC~JLlx-n=%TZHv%V<"]O:a тwo9-8N`}>+\0. ? pq^kF_g}?a yOSx`1}rkX(x % ~\bn:'f"qy"0yMM7O \Jv^}@ jYoC~:cw:zAj,|]g q!)N{Pugz0 \)3FS]F6 llWx4gt+T-]&' 6/dcDC3py6yL/$4{TX c[(Oa[/?efS„3Eb:[X;" UL& YKn5@iRze tJ\I 48/G%+?'=Ieu:-To Bf[(3DAahUndπ*['f}\D[sOF xR',E6 %w">!&eB/HqB^*WpH0;#`g^61&us)#]z1IJgQStFn=;jV @x+^ oD6~lq^v)\#Z @NZ{5r#5K-jL[* `ecA/+Xo)}!#!"! o\- _V~ MWn{H==<:cN0l@5~-@zwKi2|P/0mf~tM`(78+HhNW@Pdk/@ PM`_ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTable__cxa_finalize__libc_start_mainOSSL_CMP_SRV_CTX_get0_custom_ctxOSSL_CMP_MSG_get_bodytypeERR_newERR_set_debugERR_set_errorOSSL_CMP_MSG_dupOSSL_CMP_MSG_freeOPENSSL_sk_numOSSL_CMP_ITAV_freeOSSL_CMP_ITAV_dupOPENSSL_sk_deep_copyOPENSSL_sk_valueOSSL_CMP_ITAV_get0_typeOPENSSL_sk_new_reserveOBJ_obj2nidOSSL_CRMF_CERTTEMPLATE_newX509_get_issuer_nameOSSL_CRMF_CERTTEMPLATE_fillX509_ALGOR_newOBJ_nid2objX509_ALGOR_set0OSSL_CMP_ATAV_new_algIdOSSL_CMP_ATAV_new_rsaKeyLenOSSL_CMP_ATAV_push1OSSL_CRMF_ATTRIBUTETYPEANDVALUE_freeX509_ALGOR_freeOSSL_CRMF_CERTTEMPLATE_freeOSSL_CMP_ATAVS_freeOPENSSL_sk_freeOSSL_CMP_ITAV_get0_crlStatusListOSSL_CMP_CRLSTATUS_get0OSSL_CMP_ITAV_get0_rootCaCertX509_get_subject_nameX509_NAME_cmpOSSL_CMP_ITAV_new_rootCaKeyUpdateOPENSSL_sk_pushOSSL_CMP_ITAV_new_caCertsOSSL_CMP_ITAV_new_crlsX509_CRL_get0_lastUpdateASN1_TIME_compare__stack_chk_failOSSL_CMP_ITAV_new0_certReqTemplateX509_CRL_get_issuerX509_digest_sigASN1_OCTET_STRING_cmpASN1_OCTET_STRING_freeBIO_printfOSSL_CMP_snprint_PKIStatusInfoASN1_INTEGER_getASN1_STRING_print_exX509_get0_serialNumberASN1_INTEGER_cmpOSSL_CRMF_MSG_get0_regCtrl_oldCertIDOSSL_CRMF_CERTID_get0_serialNumberOSSL_CRMF_CERTID_get0_issuerX509_dupOSSL_CRMF_MSG_centralkeygen_requestedX509_chain_up_refOSSL_CMP_PKISI_dupOSSL_STACK_OF_X509_freeEVP_PKEY_dupOSSL_CMP_SRV_CTX_get0_cmp_ctxOSSL_CMP_CTX_set0_newPkeyEVP_PKEY_freeOSSL_CMP_STATUSINFO_newOSSL_CMP_MSG_get0_headerOSSL_CMP_HDR_get0_geninfo_ITAVsOSSL_CMP_ITAV_get0_certProfileASN1_STRING_get0_datastrcmpNCONF_get_stringOPENSSL_sk_new_nullBIO_freeERR_print_errorsBUF_MEM_freeCRYPTO_freeASN1_TYPE_freeOBJ_create_objectsstrtolASN1_ITEM_lookupBIO_putsASN1_ITEM_getBUF_MEM_newBUF_MEM_growBIO_readd2i_ASN1_TYPEASN1_TYPE_getBIO_writeASN1_item_d2iASN1_item_printASN1_item_freeNCONF_freeASN1_generate_nconfi2d_ASN1_TYPEASN1_tag2strPEM_read_bioBIO_f_base64BIO_newBIO_pushASN1_parse_dumpX509_NAME_onelineASN1_INTEGER_to_BNBN_is_zeroBN_bn2hexBN_freeTXT_DB_get_by_indexOPENSSL_strcasecmpCRYPTO_strdupASN1_GENERALIZEDTIME_set_stringX509_gmtime_adjstrlenCRYPTO_mallocOPENSSL_strlcpyOPENSSL_strlcatASN1_UTCTIME_freeX509_get0_notAftermemcpyTXT_DB_insertOBJ_txt2objASN1_OBJECT_freeX509_REVOKED_set_revocationDateX509_REVOKED_add1_ext_i2dASN1_GENERALIZEDTIME_freeASN1_ENUMERATED_freeASN1_TIME_freeASN1_ENUMERATED_newASN1_ENUMERATED_setBIO_free_allOPENSSL_cleanseTXT_DB_freeX509_CRL_freeENGINE_freeERR_set_markERR_clear_last_markBIO_new_fileASN1_STRING_set_default_mask_ascERR_pop_to_markERR_clear_errorperrorX509_check_private_keyASN1_TIME_set_string__ctype_b_loc__ctype_toupper_locASN1_TIME_newX509_time_adjEVP_PKEY_get_default_digest_nameX509V3_set_ctxX509V3_set_nconfX509V3_EXT_add_nconfBN_newNCONF_get_sectionCONF_loadX509_REQ_newX509_REQ_get_subject_nameOBJ_txt2nidNETSCAPE_SPKI_b64_decodeX509_NAME_add_entry_by_NIDX509_REQ_freeNETSCAPE_SPKI_freeX509_NAME_ENTRY_freeNETSCAPE_SPKI_get_pubkeyNETSCAPE_SPKI_verifyX509_REQ_set_pubkeyX509_get0_pubkeyX509_verifyX509_to_X509_REQBN_add_wordX509_printBIO_ctrlstdinfgetsPEM_write_bio_X509ASN1_STRING_lengthi2d_X509_bioX509_CRL_new_exX509_CRL_set_issuer_nameASN1_TIME_set_string_X509X509_CRL_set1_lastUpdateX509_CRL_set1_nextUpdateX509_REVOKED_newBN_hex2bnBN_to_ASN1_INTEGERX509_REVOKED_set_serialNumberASN1_INTEGER_freeX509_CRL_add0_revokedX509_CRL_sortX509_CRL_set_versionX509_time_adj_exX509_CRL_add1_ext_i2dEVP_MD_CTX_newEVP_MD_CTX_freeX509_CRL_sign_ctxPEM_write_bio_X509_CRLX509V3_EXT_CRL_add_nconfTXT_DB_writeOPENSSL_cipher_nameSSL_CTX_freeSSL_freeSSL_CTX_new_exSSL_CTX_ctrlSSL_CTX_set_ciphersuitesSSL_CTX_set_cipher_listSSL_newSSL_get1_supported_ciphersSSL_CIPHER_get_nameSSL_CIPHER_get_idSSL_CIPHER_descriptionSSL_CIPHER_standard_nameSSL_CTX_set_srp_client_pwd_callbackSSL_CTX_set_psk_client_callbackSSL_get_ciphersOSSL_CMP_print_to_bioX509_STORE_get0_paramX509_VERIFY_PARAM_set1_hostX509_VERIFY_PARAM_set1_ipX509_VERIFY_PARAM_set1_emailX509_VERIFY_PARAM_set_hostflagsX509_VERIFY_PARAM_set1_ip_ascOSSL_CMP_MSG_writeOSSL_CMP_MSG_readOSSL_CMP_CTX_server_performOSSL_CMP_HDR_get0_recipNonceOSSL_CMP_HDR_get0_transactionIDOSSL_CMP_CTX_set1_senderNonceOSSL_CMP_CTX_set1_transactionIDOSSL_CMP_MSG_http_performOSSL_CMP_MSG_update_transactionIDOSSL_CMP_MSG_update_recipNonceOSSL_CMP_MSG_get0_certreq_publickeyX509_PUBKEY_get0strchrASN1_TYPE_newOPENSSL_strncasecmpASN1_INTEGER_newASN1_INTEGER_setASN1_TYPE_setOSSL_CMP_ITAV_createOSSL_CMP_CTX_push0_geninfo_ITAVASN1_UTF8STRING_newASN1_STRING_setASN1_UTF8STRING_freeX509_up_refOSSL_CMP_PKISI_freeCRYPTO_clear_freeX509_STORE_add_certX509_STORE_CTX_print_verify_cbX509_STORE_set_verify_cbX509_STORE_set1_paramX509_STORE_freeX509_STORE_newOSSL_CMP_CTX_print_errorsOSSL_CMP_CTX_get0_untrustedSSL_CTX_newSSL_CTX_set_cert_storeSSL_CTX_set_verifySSL_CTX_use_certificateX509_VERIFY_PARAM_get_flagsX509_VERIFY_PARAM_clear_flagsX509_VERIFY_PARAM_set_flagsSSL_CTX_get0_certificateSSL_CTX_use_PrivateKeyOSSL_HTTP_parse_urlOSSL_CMP_CTX_set_optionBIO_snprintfOSSL_CMP_CTX_set1_server__strncat_chkOBJ_sn2nidOSSL_CMP_CTX_set1_serverPathOSSL_CMP_CTX_set1_untrustedOSSL_CMP_CTX_set1_srvCertOSSL_CMP_CTX_set0_trustedStoreOSSL_CMP_CTX_set_serverPortOSSL_CMP_CTX_set1_proxyOSSL_CMP_CTX_set1_no_proxyOSSL_HTTP_adapt_proxyOSSL_CMP_CTX_set_certConf_cb_argOSSL_CMP_CTX_set_transfer_cbCRYPTO_zallocOSSL_CMP_CTX_get_http_cb_argOSSL_CMP_CTX_set_http_cb_argOSSL_CMP_CTX_get_optionOSSL_CMP_CTX_set_http_cbOSSL_CMP_CTX_set1_secretValueOSSL_CMP_CTX_set1_referenceValueOSSL_CMP_CTX_set1_pkeyOSSL_CMP_CTX_set1_certOSSL_CMP_CTX_set1_extraCertsOutOBJ_ln2nidOSSL_CMP_CTX_set1_issuerOSSL_CMP_CTX_set1_subjectNames2i_ASN1_INTEGEROSSL_CMP_CTX_set1_serialNumberX509V3_EXT_add_nconf_skOSSL_CMP_CTX_set0_reqExtensionsOSSL_CMP_CTX_reqExtensions_have_SANOSSL_CMP_CTX_build_cert_chainOSSL_CMP_CTX_set1_p10CSRX509_EXTENSION_freeOPENSSL_sk_pop_freea2i_GENERAL_NAMEOSSL_CMP_CTX_push1_subjectAltNameGENERAL_NAME_freePOLICYINFO_newOSSL_CMP_CTX_push0_policyOSSL_CMP_CTX_set1_oldCertOSSL_CMP_CTX_set1_recipientOSSL_CMP_CTX_set1_expected_senderOSSL_CMP_ITAV_new0_certProfileASN1_STRING_freePOLICYINFO_freeBIO_s_fileunlink__errno_locationX509_add_certi2t_ASN1_OBJECTOPENSSL_dieOSSL_CMP_MSG_itOSSL_CMP_CTX_get_statusOSSL_sleepBIO_s_memOBJ_nid2lnOSSL_CMP_ATAV_get0_typeOSSL_CMP_ATAV_get_rsaKeyLenOSSL_CMP_ATAV_get0_algIdX509_ALGOR_get0i2a_ASN1_OBJECTX509_ALGOR_itOBJ_nid2snCMS_ContentInfo_new_exCMS_ContentInfo_freePEM_read_bio_CMSd2i_CMS_bioSMIME_read_CMS_exX509_STORE_CTX_get_errorGENERAL_NAME_printGENERAL_NAMES_newGENERAL_NAMES_freeX509_VERIFY_PARAM_newX509_VERIFY_PARAM_freeCMS_ReceiptRequest_freeEVP_CIPHER_freeEVP_MD_freeOPENSSL_hexstr2bufCMS_add1_signerCMS_SignerInfo_get0_pkey_ctxCMS_add1_ReceiptRequestCMS_get1_certsCMS_data_create_exEVP_aes_256_cbcCMS_digest_create_exASN1_PCTX_newASN1_PCTX_set_flagsASN1_PCTX_set_str_flagsASN1_PCTX_set_nm_flagsCMS_ContentInfo_print_ctxASN1_PCTX_freei2d_CMS_bio_streamPEM_write_bio_CMS_streamSMIME_write_CMSCMS_get0_SignerInfosCMS_sign_receiptCMS_encrypt_exCMS_add1_recipientCMS_RecipientInfo_get0_pkey_ctxEVP_CIPHER_get_nidEVP_PKEY_CTX_ctrlCMS_RecipientInfo_typeCMS_RecipientInfo_kari_get0_ctxEVP_EncryptInit_exCMS_add0_recipient_keyCMS_add0_recipient_passwordCMS_finalERR_peek_errorCMS_EncryptedData_encrypt_exCMS_dataCMS_EncryptedData_decryptCMS_uncompressCMS_digest_verifyCMS_verify_receiptCMS_verifyCMS_get0_signersCMS_ReceiptRequest_get0_valuesBIO_dump_indentCMS_get1_ReceiptRequestCMS_decrypt_set1_keyCMS_decrypt_set1_pkey_and_peerCMS_decrypt_set1_passwordCMS_decryptCMS_sign_exCMS_set1_eContentTypeCMS_ReceiptRequest_create0_exCMS_compressCMS_final_digestEVP_sha1X509_STORE_CTX_freeX509_CRL_diffX509_NAME_hash_oldX509_LOOKUP_fileX509_STORE_add_lookupX509_STORE_CTX_newX509_STORE_CTX_initX509_STORE_CTX_get_obj_by_subjectX509_OBJECT_get0_X509X509_get_pubkeyX509_OBJECT_freeX509_CRL_verifyX509_CRL_get0_nextUpdateASN1_TIME_print_exX509_NAME_hash_exX509_CRL_get_ext_d2ii2a_ASN1_INTEGERX509_CRL_digestEVP_MD_get0_nameX509_CRL_get0_signatureX509_CRL_print_exi2d_X509_CRL_bioPKCS7_freePKCS7_newPKCS7_SIGNED_newPEM_X509_INFO_read_bioOPENSSL_sk_shiftX509_INFO_freePEM_read_bio_X509_CRLd2i_X509_CRL_bioPEM_write_bio_PKCS7i2d_PKCS7_biostrstrEVP_MD_fetchEVP_get_digestbynameEVP_DigestSignFinalEVP_DigestVerifyFinalEVP_DigestFinalXOFBIO_getsEVP_DigestSignEVP_DigestVerifyOBJ_NAME_do_all_sortedBIO_f_mdEVP_PKEY_CTX_freeEVP_PKEY_new_raw_private_keyEVP_DigestVerifyInitEVP_PKEY_get0_type_nameBIO_debug_callback_exBIO_set_callback_exBIO_set_callback_argEVP_DigestInit_exEVP_DigestSignInitEVP_DigestVerifyInit_exEVP_DigestSignInit_exEVP_PKEY_get_sizeEVP_sha256EVP_MD_xofEVP_MD_CTX_get1_mdEVP_PKEY_get_bn_paramOSSL_PARAM_freeOSSL_PARAM_BLD_freeOSSL_PARAM_BLD_newOSSL_PARAM_BLD_push_BNOSSL_PARAM_BLD_to_paramEVP_PKEY_CTX_new_from_nameEVP_PKEY_fromdata_initEVP_PKEY_fromdataEVP_PKEY_CTX_set_app_dataEVP_PKEY_paramgen_initEVP_PKEY_CTX_set_dsa_paramgen_bitsOSSL_ENCODER_CTX_new_for_pkeyOSSL_ENCODER_to_bioOSSL_ENCODER_CTX_freeOSSL_DECODER_CTX_new_for_pkeyOSSL_DECODER_from_bioOSSL_DECODER_CTX_freeEVP_PKEY_is_aEVP_PKEY_CTX_set_dh_paramgen_prime_lenEVP_PKEY_CTX_set_dh_paramgen_generatorEVP_PKEY_CTX_set_cbEVP_PKEY_CTX_new_from_pkeyEVP_PKEY_param_checkEVP_PKEY_print_paramsEVP_PKEY_print_privateOSSL_ENCODER_CTX_get_num_encodersEVP_CIPHER_get0_nameOSSL_ENCODER_CTX_set_cipherOSSL_ENCODER_CTX_set_passphrase_uiOSSL_ENCODER_CTX_set_passphraseOSSL_PARAM_construct_intOSSL_ENCODER_CTX_set_paramsBN_printEVP_PKEY_print_publicEVP_PKEY_CTX_set_dsa_paramgen_q_bitsEVP_PKEY_keygen_initPEM_write_bio_PrivateKeyi2d_KeyParams_bioPEM_write_bio_Parametersi2d_PrivateKey_bio__memcpy_chkOSSL_CMP_CTX_newOSSL_CMP_CTX_set_log_cbOSSL_CMP_CTX_get_transfer_cb_argOSSL_CMP_SRV_CTX_freeOSSL_CMP_CTX_get_certConf_cb_argOSSL_CMP_CTX_freeOSSL_CMP_log_closeaccessUI_nullOSSL_CMP_exec_RR_sesOSSL_CMP_CTX_snprint_PKIStatusOSSL_CMP_CTX_get0_validatedSrvCertOSSL_CMP_CTX_get1_extraCertsInOSSL_CMP_CTX_get1_newChainOSSL_CMP_CTX_get1_caPubsOSSL_CMP_CTX_reinitOSSL_CMP_exec_certreqOSSL_CMP_CTX_push0_genm_ITAVOSSL_CMP_exec_GENM_sesOSSL_CMP_CTX_get0_newPkeyEVP_CIPHER_fetchOSSL_CMP_SRV_CTX_newOSSL_CMP_PKISI_newOSSL_CMP_SRV_CTX_initOSSL_CMP_SRV_CTX_init_transEVP_PKEY_up_refX509_CRL_up_refOSSL_CMP_get1_rootCaKeyUpdateOSSL_CMP_get1_certReqTemplateOSSL_CMP_get1_crlUpdateOSSL_CMP_CTX_set_transfer_cb_argOSSL_CMP_SRV_CTX_set_accept_raverifiedOSSL_CMP_SRV_CTX_set_accept_unprotectedOSSL_CMP_SRV_CTX_set_send_unprotected_errorsOSSL_CMP_SRV_CTX_set_grant_implicit_confirmi2d_OSSL_CRMF_CERTTEMPLATEASN1_i2d_bioi2d_OSSL_CMP_ATAVSOSSL_CMP_get1_caCertsX509_NAME_freeEVP_PKEY_set_utf8_string_paramEVP_PKEY_set_int_paramEVP_PKEY_checkOSSL_PARAM_construct_utf8_stringOSSL_PARAM_construct_endEVP_PKEY_CTX_set_paramsEVP_PKEY_keygenEVP_PKEY_set_octet_string_paramEC_get_builtin_curvesEVP_default_properties_is_fips_enabledEVP_get_cipherbynameEVP_CIPHER_get_flagsEVP_CIPHER_get_modememsetOPENSSL_hexchar2intEVP_CIPHER_get_key_lengthEVP_CIPHER_get_iv_lengthPKCS5_PBKDF2_HMACEVP_SKEYMGMT_freeEVP_SKEY_freeEVP_read_pw_stringBIO_new_fpBIO_f_zlibEVP_BytesToKeyBIO_f_cipherEVP_SKEYMGMT_fetchEVP_SKEYMGMT_get0_imp_settable_paramsEVP_SKEYMGMT_get0_nameEVP_SKEY_importEVP_CipherInit_SKEYBIO_number_readBIO_number_writtenEVP_CIPHER_CTX_set_flagsEVP_CipherInit_exBIO_set_flagsEVP_CIPHER_CTX_set_paddingRAND_bytes__printf_chkputcharstrcpyCRYPTO_reallocOSSL_STORE_LOADER_get0_engineOSSL_STORE_LOADER_get0_schemeENGINE_by_idENGINE_get_nameENGINE_get_idENGINE_ctrlENGINE_get_RSAENGINE_get_ECENGINE_get_DSAENGINE_get_DHENGINE_get_RANDENGINE_get_ciphersENGINE_initENGINE_finishENGINE_get_digestsENGINE_get_pkey_methsENGINE_get_firstENGINE_get_nextOSSL_STORE_do_all_loadersstdoutERR_print_errors_fpOPENSSL_init_ssl__isoc99_sscanfERR_error_string_nEVP_PKEY_get_bitsOPENSSL_infoEVP_KDF_freeEVP_KDF_CTX_freeEVP_KDF_fetchEVP_KDF_CTX_newEVP_KDF_settable_ctx_paramsEVP_KDF_CTX_set_paramsEVP_KDF_deriveOPENSSL_buf2hexstrOSSL_PROVIDER_get0_nameEVP_CIPHER_get0_providerEVP_CIPHER_up_refOPENSSL_sk_newEVP_CIPHER_do_all_providedOPENSSL_sk_sortEVP_CIPHER_is_aEVP_CIPHER_names_do_allEVP_CIPHER_get0_descriptionEVP_CIPHER_gettable_paramsEVP_CIPHER_gettable_ctx_paramsEVP_CIPHER_settable_ctx_paramsEVP_CIPHER_do_all_sortedEVP_MD_get0_providerEVP_MD_up_refEVP_MD_do_all_providedEVP_MD_is_aEVP_MD_names_do_allEVP_MD_get0_descriptionEVP_MD_gettable_paramsEVP_MD_gettable_ctx_paramsEVP_MD_settable_ctx_paramsEVP_MD_do_all_sortedEVP_MAC_get0_providerEVP_MAC_get0_nameEVP_MAC_fetchEVP_MAC_freeEVP_MAC_up_refEVP_MAC_do_all_providedEVP_MAC_is_aEVP_MAC_names_do_allEVP_MAC_get0_descriptionEVP_MAC_gettable_paramsEVP_MAC_gettable_ctx_paramsEVP_MAC_settable_ctx_paramsEVP_KDF_get0_providerEVP_KDF_get0_nameEVP_KDF_up_refEVP_KDF_do_all_providedEVP_KDF_is_aEVP_KDF_names_do_allEVP_KDF_get0_descriptionEVP_KDF_gettable_paramsEVP_KDF_gettable_ctx_paramsEVP_RAND_get0_nameEVP_RAND_get0_providerEVP_RAND_fetchEVP_RAND_freeEVP_RAND_up_refEVP_RAND_CTX_get0_randEVP_RAND_get_stateEVP_RAND_gettable_ctx_paramsEVP_RAND_CTX_get_paramsOSSL_PARAM_get_uint64OSSL_PARAM_get_int64OSSL_ENCODER_get0_providerOSSL_ENCODER_get0_nameOSSL_ENCODER_fetchOSSL_ENCODER_freeOSSL_ENCODER_up_refOSSL_ENCODER_do_all_providedOSSL_ENCODER_is_aOSSL_ENCODER_names_do_allOSSL_ENCODER_get0_propertiesOSSL_ENCODER_get0_descriptionOSSL_ENCODER_settable_ctx_paramsOSSL_DECODER_get0_providerOSSL_DECODER_get0_nameOSSL_DECODER_fetchOSSL_DECODER_freeOSSL_DECODER_up_refOSSL_DECODER_do_all_providedOSSL_DECODER_is_aOSSL_DECODER_names_do_allOSSL_DECODER_get0_propertiesOSSL_DECODER_get0_descriptionOSSL_DECODER_settable_ctx_paramsEVP_KEYMGMT_get0_providerEVP_KEYMGMT_get0_nameEVP_KEYMGMT_fetchEVP_KEYMGMT_freeEVP_KEYMGMT_up_refEVP_KEYMGMT_do_all_providedEVP_KEYMGMT_is_aEVP_KEYMGMT_names_do_allEVP_KEYMGMT_get0_descriptionEVP_KEYMGMT_gen_settable_paramsEVP_KEYMGMT_settable_paramsEVP_KEYMGMT_gettable_paramsEVP_SKEYMGMT_get0_providerEVP_SKEYMGMT_up_refEVP_SIGNATURE_get0_providerEVP_SIGNATURE_get0_nameEVP_SIGNATURE_fetchEVP_SIGNATURE_freeEVP_SIGNATURE_up_refEVP_SIGNATURE_do_all_providedEVP_SIGNATURE_is_aEVP_SIGNATURE_names_do_allEVP_SIGNATURE_get0_descriptionEVP_SIGNATURE_settable_ctx_paramsEVP_SIGNATURE_gettable_ctx_paramsOSSL_PARAM_locate_constOSSL_PROVIDER_get_capabilitiesEVP_KEM_get0_providerEVP_KEM_get0_nameEVP_KEM_fetchEVP_KEM_freeEVP_KEM_up_refEVP_KEM_do_all_providedEVP_KEM_is_aEVP_KEM_names_do_allEVP_KEM_get0_descriptionEVP_KEM_settable_ctx_paramsEVP_KEM_gettable_ctx_paramsEVP_ASYM_CIPHER_get0_providerEVP_ASYM_CIPHER_get0_nameEVP_ASYM_CIPHER_fetchEVP_ASYM_CIPHER_freeEVP_ASYM_CIPHER_up_refEVP_ASYM_CIPHER_do_all_providedEVP_ASYM_CIPHER_is_aEVP_ASYM_CIPHER_names_do_allEVP_ASYM_CIPHER_get0_descriptionEVP_ASYM_CIPHER_settable_ctx_paramsEVP_ASYM_CIPHER_gettable_ctx_paramsEVP_KEYEXCH_get0_providerEVP_KEYEXCH_get0_nameEVP_KEYEXCH_fetchEVP_KEYEXCH_freeEVP_KEYEXCH_up_refEVP_KEYEXCH_do_all_providedEVP_KEYEXCH_is_aEVP_KEYEXCH_names_do_allEVP_KEYEXCH_get0_descriptionEVP_KEYEXCH_settable_ctx_paramsEVP_KEYEXCH_gettable_ctx_paramsENGINE_get_digest_engineENGINE_get_cipher_engineOSSL_STORE_LOADER_get0_providerOSSL_STORE_LOADER_up_refOSSL_STORE_LOADER_freeOSSL_STORE_LOADER_do_all_providedOSSL_STORE_LOADER_is_aOSSL_STORE_LOADER_names_do_allEVP_RAND_do_all_providedEVP_RAND_get0_descriptionEVP_RAND_gettable_paramsEVP_RAND_settable_ctx_paramsRAND_get0_primaryRAND_get0_publicRAND_get0_privateEVP_SKEYMGMT_do_all_providedEVP_SKEYMGMT_is_aEVP_SKEYMGMT_names_do_allEVP_SKEYMGMT_get0_descriptionSSL_get1_builtin_sigalgsOSSL_PROVIDER_do_allTLS_methodOBJ_new_nidOBJ_obj2txtOSSL_PARAM_construct_utf8_ptrOSSL_PARAM_set_all_unmodifiedOSSL_PROVIDER_get_paramsOSSL_PARAM_modifiedOSSL_PROVIDER_gettable_paramsEVP_PKEY_meth_get_countEVP_PKEY_meth_get0EVP_PKEY_meth_get0_infoEVP_PKEY_asn1_get_countEVP_PKEY_asn1_get0EVP_PKEY_asn1_get0_infoEVP_PKEY_CTX_new_idPEM_read_bio_Parameters_exEVP_PKEY_CTX_newEVP_PKEY_CTX_settable_paramsstrerrori2d_PUBKEY_bioPEM_write_bio_PUBKEYBN_GENCB_newBN_GENCB_freeEVP_PKEY_CTX_set_rsa_keygen_bitsBN_set_wordEVP_PKEY_CTX_set1_rsa_keygen_pubexpEVP_PKEY_CTX_set_rsa_keygen_primesPEM_write_bio_PrivateKey_traditionalBN_bn2decEVP_MAC_CTX_freeEVP_MAC_CTX_newEVP_MAC_CTX_set_paramsEVP_MAC_initEVP_MAC_updateEVP_MAC_finalNETSCAPE_CERT_SEQUENCE_freeNETSCAPE_CERT_SEQUENCE_newPEM_read_bio_X509PEM_read_bio_NETSCAPE_CERT_SEQUENCEPEM_write_bio_NETSCAPE_CERT_SEQUENCEstrncmpOPENSSL_LH_retrieveOPENSSL_LH_strhashqsortOPENSSL_LH_newOPENSSL_LH_set_thunksOPENSSL_LH_insertPKCS12_SAFEBAG_get0_attrsX509_ATTRIBUTE_createX509at_add1_attrPKCS12_SAFEBAG_set0_attrsX509_ATTRIBUTE_freePKCS12_freeOSSL_PROVIDER_availableX509_STORE_CTX_new_exX509_verify_certX509_STORE_CTX_get1_chainX509_add_certsX509_alias_set1EVP_PKEY_add1_attr_by_NIDPKCS12_create_ex2PKCS12_set_maci2d_PKCS12_bioPKCS12_init_exd2i_PKCS12_bioPKCS12_get0_macPKCS12_verify_macPKCS12_unpack_authsafesPKCS12_unpack_p7encdataPKCS12_SAFEBAG_freePKCS12_unpack_p7dataEVP_des_ede3_cbcX509_keyid_set1OPENSSL_sk_deletePKCS12_mac_presentX509_verify_cert_error_stringPKCS12_set_pbmac1_pbkdf2PBMAC1_get1_pbkdf2_paramPBKDF2PARAM_freeOPENSSL_asc2uniOPENSSL_uni2utf8PKCS7_new_exPEM_read_bio_PKCS7d2i_PKCS7_bioPKCS7_print_ctxX509_SIG_freePKCS8_PRIV_KEY_INFO_freed2i_PKCS8_PRIV_KEY_INFO_bioEVP_PKCS82PKEYEVP_PBE_findd2i_PKCS8_bioPKCS8_decryptEVP_PKEY2PKCS8PEM_read_bio_PKCS8PEM_read_bio_PKCS8_PRIV_KEY_INFOPKCS5_pbe2_set_ivPKCS8_set0_pbei2d_PKCS8_PRIV_KEY_INFO_bioi2d_PKCS8_bioPEM_write_bio_PKCS8_PRIV_KEY_INFOPKCS5_pbe_setPKCS5_pbe2_set_scryptPEM_write_bio_PKCS8EVP_PKEY_set_paramsEVP_PKEY_public_checkEVP_PKEY_encryptEVP_PKEY_decapsulateEVP_PKEY_signEVP_PKEY_deriveEVP_PKEY_decryptEVP_PKEY_verify_recoverEVP_PKEY_encapsulateEVP_DigestVerifyUpdateEVP_DigestSignUpdateEVP_PKEY_verify_initEVP_PKEY_CTX_get0_pkeyEVP_PKEY_derive_set_peerEVP_PKEY_CTX_ctrl_strEVP_PKEY_encrypt_initEVP_PKEY_decapsulate_initEVP_PKEY_CTX_set_kem_opEVP_PKEY_derive_initEVP_MD_CTX_set_pkey_ctxEVP_PKEY_verifyEVP_PKEY_sign_initEVP_PKEY_decrypt_initBIO_dumpEVP_PKEY_verify_recover_initEVP_PKEY_encapsulate_initBN_generate_prime_exBN_check_primeBN_dec2bnRAND_bytes_exstrtoulreadlinkOCSP_RESPONSE_itOCSP_REQUEST_itASN1_item_i2d_mem_bioOSSL_HTTP_transferASN1_item_d2i_bioOCSP_REQUEST_freeOCSP_RESPONSE_freeOCSP_BASICRESP_freeX509V3_conf_freeX509V3_add_valueX509_get0_pubkey_bitstrOCSP_cert_id_newOCSP_request_add0_idOCSP_cert_to_idOCSP_REQUEST_newopenlogsetpgidsignalwaitpid__syslog_chkOCSP_request_signOCSP_REQUEST_printi2d_OCSP_REQUESTOCSP_request_onereq_countOCSP_BASICRESP_newOCSP_request_onereq_get0OCSP_onereq_get0_idOCSP_id_get0_infoOCSP_id_issuer_cmpOCSP_CERTID_freeOCSP_copy_nonceOCSP_basic_sign_ctxOCSP_response_createi2d_OCSP_RESPONSEOCSP_response_statusOCSP_RESPONSE_printOCSP_request_add1_nonceOCSP_RESPONSE_newd2i_OCSP_RESPONSEASN1_d2i_bioOCSP_response_status_strforkd2i_OCSP_REQUESTOCSP_basic_add1_statusOCSP_SINGLERESP_add1_ext_i2d_exitRAND_pollOCSP_response_get1_basicOCSP_check_nonceOCSP_basic_verifyOCSP_check_validityOCSP_cert_status_strASN1_GENERALIZEDTIME_printOCSP_crl_reason_strOCSP_resp_find_statusOCSP_resp_get0_signaturestderrOPENSSL_LH_freeRAND_write_fileOSSL_LIB_CTX_freeOSSL_STORE_unregister_loaderUI_destroy_methodUI_OpenSSLUI_create_methodUI_method_set_openerOSSL_STORE_LOADER_newOSSL_STORE_LOADER_set_opengetenvCONF_get1_default_config_fileUI_method_set_readerUI_method_set_writerUI_method_set_closerUI_method_set_prompt_constructorOSSL_STORE_LOADER_set_expectOSSL_STORE_LOADER_set_loadOSSL_STORE_LOADER_set_eofOSSL_STORE_LOADER_set_errorOSSL_STORE_LOADER_set_closeOSSL_STORE_register_loaderOSSL_LIB_CTX_newEVP_md5EVP_DigestUpdateEVP_DigestFinal_exOPENSSL_uni2ascOPENSSL_DIR_readOPENSSL_DIR_endlstatstrrchrX509_digest__memset_chksymlinkEVP_MD_get_sizeX509_get_default_cert_dir_envstrtokX509_get_default_cert_dirEVP_PKEY_get0_RSAi2b_PublicKey_bioPEM_write_bio_RSA_PUBKEYi2d_RSA_PUBKEY_bioPEM_write_bio_RSAPublicKeyi2d_RSAPublicKey_bioEVP_PKEY_CTX_set_rsa_paddingSSL_SESSION_up_refSSL_SESSION_get0_cipherSSL_CIPHER_get_handshake_digestSSL_SESSION_freeSSL_CIPHER_findSSL_SESSION_newSSL_SESSION_set1_master_keySSL_SESSION_set_cipherSSL_SESSION_set_protocol_versionSSL_get_servernameSSL_get_servername_typeSSL_session_reusedSSL_select_next_protoPEM_write_bioPEM_write_bio_SSL_SESSIONSSL_SESSION_printOPENSSL_LH_doallX509_print_exPEM_write_bio_X509_REQ_NEWOPENSSL_LH_errorNCONF_get_number_ePEM_read_bio_ParametersCRYPTO_strndupOSSL_PARAM_construct_size_tEVP_PKEY_CTX_is_afilenoisattyX509V3_EXT_REQ_add_nconfX509_REQ_set_subject_nameX509_REQ_get0_pubkeyPEM_write_bio_X509_REQi2d_X509_REQ_bioX509_new_exX509_set_serialNumberX509_set_issuer_nameX509_set_subject_nameX509_set_pubkeyX509_add1_ext_i2dX509_get_serialNumberX509V3_set_issuer_pkeyX509_REQ_new_exX509_REQ_set_versionX509_REQ_print_exX509_NAME_add_entry_by_txtX509_NAME_entry_countX509_REQ_add1_attr_by_txtX509_REQ_add1_attr_by_NIDSSL_ctrlSSL_key_updateSSL_stream_concludeSSL_is_quicSSL_set_connect_stateSSL_get_fdBIO_closesocketSSL_renegotiateSSL_get_SSL_CTXSSL_get_current_cipherSSL_CIPHER_get_versionSSL_get_versionSSL_get_current_compressionSSL_get_current_expansionSSL_COMP_get_nameSSL_get_wbioSSL_get_rbioSSL_get0_next_proto_negotiatedSSL_get0_alpn_selectedSSL_get_selected_srtp_profileSSL_get_sessionSSL_export_keying_materialSSL_get_early_data_statusSSL_get_verify_resultSSL_get_peer_cert_chainX509_NAME_print_exEVP_PKEY_get_idX509_get_signature_nidX509_get0_notBeforeASN1_TIME_printSSL_get0_peer_certificateSSL_get_negotiated_client_cert_typeSSL_get_negotiated_server_cert_typeEVP_PKEY_get_group_nameEVP_PKEY_get_base_idSSL_get0_peer_rpkSSL_ct_is_enabledSSL_get0_peer_sctsSSL_CTX_get0_ctlog_storeSCT_validation_status_stringSCT_printSSL_CONF_CTX_newSSL_CONF_CTX_set_flagsBIO_ADDR_freeSSL_CONF_CTX_freeOSSL_QUIC_client_methodDTLS_client_methodBIO_parse_hostservSSL_CTX_configSSL_CTX_set_default_read_buffer_lenSSL_CTX_set_tlsext_max_fragment_lengthSSL_add_file_cert_subjects_to_stackSSL_CTX_set0_CA_listSSL_CTX_set_client_cert_enginePEM_read_bio_SSL_SESSIONSSL_CTX_set_psk_use_session_callbackSSL_CTX_set_tlsext_use_srtpSSL_CTX_set_cert_cbSSL_CTX_set_next_proto_select_cbSSL_CTX_set_alpn_protosSSL_CTX_add_client_custom_extSSL_CTX_enable_ctSSL_CTX_set_ctlog_list_fileSSL_CTX_set_srp_usernameSSL_CTX_set_srp_cb_argSSL_CTX_set_srp_strengthSSL_CTX_set_srp_verify_param_callbackSSL_CTX_dane_enableSSL_CTX_sess_set_new_cbSSL_set_sessionSSL_dane_enableSSL_dane_tlsa_addSSL_set1_server_cert_typeSSL_dane_set_flagsBIO_sock_initBIO_lookup_exBIO_ADDRINFO_socktypeBIO_ADDRINFO_nextBIO_ADDRINFO_familyBIO_ADDRINFO_protocolBIO_socketBIO_ADDRINFO_addressBIO_bindBIO_connectBIO_ADDR_dupBIO_ADDR_hostname_stringBIO_ADDRINFO_freeBIO_new_dgramBIO_ADDR_newBIO_sock_infoSSL_set_optionsSSL_set_msg_callbackSSL_set_bioOSSL_HTTP_proxy_connectSSL_CTX_callback_ctrlBIO_f_bufferBIO_popstrncpySSL_SESSION_get_max_early_dataSSL_is_init_finished__fdelt_chkselectSSL_handle_eventsSSL_readSSL_get_errorSSL_has_pendingSSL_net_read_desiredSSL_net_write_desiredBIO_read_exSSL_write_early_dataSSL_get_key_update_typeSSL_get_event_timeoutSSL_writeSSL_callback_ctrlNCONF_newNCONF_load_bioASN1_get_objectSSL_traceBIO_f_nbio_testBIO_new_socketBIO_socket_nbioSSL_set_blocking_modeSSL_set1_initial_peer_addrBIO_new_dgram_sctpBIO_s_nullSSL_CTX_set1_paramSSL_CTX_set_optionsSSL_CTX_set_info_callbackSSL_CTX_set_default_ctlog_list_fileSSL_set1_client_cert_typeSSL_set_post_handshake_authSSL_is_dtlsSSL_set_SSL_CTXSSL_get_certificateX509_get1_ocspSSL_CTX_get_cert_storeX509_email_freeOCSP_REQUEST_add_extSSL_has_matching_session_idBIO_get_callback_argBIO_f_sslBIO_int_ctrlSSL_set_session_id_contextSSL_set_accept_stateBIO_test_flagsBIO_get_retry_reasonBUF_reverseSSL_get_shared_ciphersSSL_get_optionsSSL_clearSSL_read_early_dataSSL_waiting_for_asyncSSL_statelessSSL_acceptSSL_set_verifySSL_verify_client_post_handshakeSSL_do_handshakeDTLSv1_listenfstatSSL_sendfileSSL_SESSION_get_idi2d_SSL_SESSIONCRYPTO_memdupd2i_SSL_SESSION_exSSL_CTX_sess_set_get_cbSSL_CTX_sess_set_remove_cbSSL_CTX_set_generate_session_idSSL_CTX_set_next_protos_advertised_cbSSL_CTX_set_alpn_select_cbSSL_CTX_set0_tmp_dh_pkeySSL_CTX_use_serverinfo_fileSSL_CTX_set_psk_server_callbackSSL_CTX_use_psk_identity_hintSSL_CTX_set_psk_find_session_callbackSSL_CTX_set_session_id_contextSSL_CTX_set_cookie_generate_cbSSL_CTX_set_cookie_verify_cbSSL_CTX_set_stateless_cookie_generate_cbSSL_CTX_set_stateless_cookie_verify_cbSRP_VBASE_newSRP_VBASE_initSSL_CTX_set_srp_username_callbackSSL_CTX_set_max_early_dataSSL_CTX_set_recv_max_early_dataDTLS_server_methodBIO_listenBIO_ADDR_rawportBIO_sock_should_retryBIO_accept_exBIO_set_tcp_ndelaySSL_CTX_set1_client_cert_typeSSL_CTX_set1_server_cert_typeSSL_CTX_compress_certsSSL_load_client_CA_fileSSL_CTX_set_client_CA_listSSL_CTX_set_not_resumable_session_callbackBIO_s_connectSSL_connectsetsockoptSSL_CTX_set_quiet_shutdownSSL_CTX_use_certificate_fileSSL_CTX_use_PrivateKey_fileSSL_CTX_check_private_keytimesSSL_set_shutdownfputcfflushsysconfSSL_SESSION_get0_peerSSL_SESSION_set1_id_contextd2i_SSL_SESSIONSSL_SESSION_print_keylogEVP_SKEYMGMT_get0_gen_settable_paramsEVP_SKEY_generateEVP_SKEY_get0_key_idEVP_SKEY_get0_provider_nameEVP_SKEY_get0_skeymgmt_namePKCS7_sign_add_signerPKCS7_verifyPKCS7_get0_signersPKCS7_encrypt_exi2d_PKCS7_bio_streamSMIME_read_PKCS7_exPKCS7_sign_exPKCS7_add_certificateSMIME_write_PKCS7PKCS7_decryptPKCS7_finalPEM_write_bio_PKCS7_streamEVP_CipherEVP_EncryptFinal_exEVP_EncryptUpdateEVP_DecryptFinal_exEVP_DecryptUpdateEVP_CIPHER_CTX_ctrlEVP_DecryptInit_exalarmEVP_DigestInitEVP_CIPHER_CTX_newEVP_CIPHER_CTX_freeEVP_CIPHER_CTX_set_key_lengthEVP_CIPHER_CTX_get0_cipherEVP_CIPHER_CTX_get_block_sizeASYNC_start_jobASYNC_WAIT_CTX_get_all_fdsERR_peek_last_errorEVP_PKEY_CTX_set_ec_paramgen_curve_nidEVP_PKEY_paramgenERR_get_errorASYNC_is_capableASYNC_WAIT_CTX_freeASYNC_cleanup_threadASYNC_WAIT_CTX_newmlockASYNC_init_threadEVP_CIPHER_CTX_get_key_lengthEVP_CIPHER_CTX_rand_keyfwrite__fprintf_chkpipefdopenstrtodfclosewaitOpenSSL_versionBN_optionsOSSL_PARAM_construct_octet_stringd2i_PrivateKeyCRYPTO_memcmpEVP_PKEY_newEVP_PKEY_CTX_set_dh_nidBN_bin2bnEVP_PKEY_sign_message_initEVP_PKEY_verify_message_initOSSL_PARAM_construct_uintSRP_create_verifierBIO_vprintfa2i_ASN1_INTEGERTS_RESP_CTX_set_status_infoTS_RESP_CTX_add_failure_infoOSSL_PROVIDER_unloadOSSL_PROVIDER_add_conf_parameterASN1_OCTET_STRING_newASN1_OCTET_STRING_setX509_set0_distinguishing_idX509_REQ_set0_distinguishing_idX509_get_extension_flagsX509_cmp_timeframeX509_POLICY_NODE_printX509_get0_extensionsX509V3_EXT_nconfX509_EXTENSION_get_objectX509v3_get_ext_by_OBJX509v3_get_extX509_EXTENSION_get_dataX509_delete_extX509_add_extX509_VERIFY_PARAM_get0_hostBIO_ssl_shutdownOSSL_PROVIDER_loadOSSL_PROVIDER_set_default_search_pathRAND_load_fileSSL_CTX_load_verify_storeSSL_CTX_load_verify_fileSSL_CTX_load_verify_dirSSL_CTX_set_default_verify_fileSSL_CTX_set_default_verify_storeSSL_CTX_set_default_verify_dirsetbufBIO_new_fdNCONF_new_exOBJ_createEVP_DigestFinalOSSL_STORE_open_exOSSL_STORE_eofOSSL_STORE_loadOSSL_STORE_INFO_get_typeOSSL_STORE_INFO_get1_PUBKEYOSSL_STORE_INFO_freeOSSL_STORE_INFO_get1_PARAMSOSSL_STORE_INFO_get1_CRLOSSL_STORE_INFO_get1_CERTOSSL_STORE_INFO_get1_PKEYOSSL_STORE_closeOSSL_STORE_INFO_type_stringOSSL_STORE_expectOSSL_STORE_attachX509_load_httpX509_STORE_set_flagsX509_STORE_CTX_set0_trusted_stackX509_STORE_CTX_set0_crlsX509_STORE_CTX_get_num_untrustedX509_NAME_print_ex_fpX509_CRL_load_httpGENERAL_NAME_get0_valueX509_STORE_CTX_get_current_certX509_get_ext_d2iDIST_POINT_freeX509_REQ_get_extensionsX509_get_ext_by_OBJX509_STORE_CTX_get_error_depthX509_LOOKUP_storeX509_LOOKUP_ctrl_exX509_LOOKUP_hash_dirX509_LOOKUP_ctrlBN_randTXT_DB_create_indexX509_STORE_CTX_get0_policy_treeX509_STORE_CTX_get_explicit_policyX509_policy_tree_get0_policiesX509_policy_tree_get0_user_policiesX509_STORE_CTX_get0_parent_ctxX509_set_versionX509_sign_ctxX509_REQ_sign_ctxX509_REQ_verify_exBIO_f_prefixOSSL_STORE_errorOSSL_STORE_INFO_get0_PKEYOSSL_STORE_INFO_get0_PUBKEYOSSL_STORE_INFO_get0_PARAMSOSSL_STORE_INFO_get0_CRLOSSL_STORE_INFO_get0_NAMEOSSL_STORE_INFO_get0_NAME_descriptionOSSL_STORE_INFO_get0_CERTX509_CRL_printOSSL_STORE_supports_searchOSSL_STORE_findOSSL_STORE_SEARCH_by_nameOSSL_STORE_SEARCH_freeOSSL_STORE_SEARCH_by_issuer_serialOSSL_STORE_SEARCH_by_aliasOSSL_STORE_SEARCH_by_key_fingerprintNETSCAPE_SPKI_newNETSCAPE_SPKI_set_pubkeyNETSCAPE_SPKI_signNETSCAPE_SPKI_b64_encodeNETSCAPE_SPKI_printCONF_modules_loadd2i_TS_REQ_bioTS_REQ_to_TS_VERIFY_CTXTS_VERIFY_CTX_add_flagsTS_VERIFY_CTX_set0_storeTS_VERIFY_CTX_set0_certsTS_REQ_freeTS_RESP_verify_tokenTS_RESP_freeTS_VERIFY_CTX_freeTS_REQ_print_bioPKCS7_to_TS_TST_INFOTS_RESP_newTS_STATUS_INFO_newTS_STATUS_INFO_set_statusTS_RESP_set_status_infoTS_TST_INFO_freeTS_STATUS_INFO_freeTS_CONF_get_tsa_sectionTS_RESP_CTX_newTS_CONF_set_serialTS_CONF_set_crypto_deviceTS_CONF_set_signer_certTS_CONF_set_certsTS_CONF_set_signer_keyTS_RESP_CTX_set_signer_digestTS_CONF_set_ess_cert_id_digestTS_CONF_set_def_policyTS_CONF_set_policiesTS_CONF_set_digestsTS_CONF_set_accuracyTS_CONF_set_clock_precision_digitsTS_CONF_set_orderingTS_CONF_set_tsa_nameTS_CONF_set_ess_cert_id_chainTS_RESP_create_responseTS_RESP_CTX_freeTS_RESP_get_tst_infoTS_TST_INFO_print_bioTS_RESP_get_tokeni2d_TS_REQ_bioTS_REQ_newTS_REQ_set_versionTS_MSG_IMPRINT_newEVP_MD_get_typeTS_MSG_IMPRINT_set_algoTS_MSG_IMPRINT_set_msgTS_REQ_set_msg_imprintTS_REQ_set_policy_idTS_REQ_set_nonceTS_REQ_set_cert_reqTS_MSG_IMPRINT_freed2i_TS_RESP_bioi2d_TS_RESP_bioTS_VERIFY_CTX_newTS_VERIFY_CTX_set0_dataTS_VERIFY_CTX_set0_imprintTS_RESP_set_tst_infoTS_RESP_verify_responseTS_RESP_print_bioTS_CONF_set_signer_digestTXT_DB_readSRP_get_default_gNPEM_read_bio_X509_REQd2i_X509_REQ_bioSSL_get_all_async_fdsOSSL_PARAM_allocate_from_textRAND_statusX509V3_parse_listX509_PURPOSE_get0X509_PURPOSE_get0_nameX509_PURPOSE_get0_snameX509_PURPOSE_get_countX509_VERIFY_PARAM_get0X509_VERIFY_PARAM_get0_nameX509_VERIFY_PARAM_get_countX509_STORE_set_lookup_crlsX509_getm_notBeforeX509_getm_notAfterX509_STORE_set_default_paths_exX509_add1_trust_objectX509_add1_reject_objectX509_get_ext_countX509_get_extX509_reject_clearX509_trust_clearOBJ_cmpX509_check_hostX509_check_emailX509_check_ip_ascPEM_write_bio_X509_AUXX509_cmp_timeX509_ocspid_printX509_subject_name_hash_oldX509_issuer_name_hash_oldX509_issuer_name_hashX509_check_purposeX509_PURPOSE_get_idX509_alias_get0X509_subject_name_hashX509V3_extensions_printX509_get1_emailX509_get0_signatureX509_STORE_CTX_set_flagsX509_REQ_add_extensionsUI_method_get_openerUI_get_input_flagsUI_get0_user_dataUI_get_string_typeUI_method_get_readerUI_set_resultUI_method_get_writerUI_method_get_closerUI_construct_prompt__strncpy_chkOSSL_STORE_INFO_new_PKEYENGINE_load_private_keyENGINE_load_public_keyOSSL_STORE_INFO_new_PUBKEYSSL_alert_desc_string_longSSL_alert_type_string_longSSL_state_string_longBIO_ADDR_rawaddressEVP_Q_macSSL_certs_clearSSL_check_chainSSL_use_certificateSSL_use_PrivateKeyEC_curve_nid2nistEVP_PKEY_get0_asn1EVP_PKEY_CTX_get_app_dataEVP_PKEY_CTX_get_keygen_infoSSL_get_srp_NSSL_get_srp_gSRP_check_known_gN_paramBN_num_bitsBN_CTX_newBN_is_oddBN_CTX_freeBN_rshift1BN_mod_expBN_cmpSSL_set_srp_server_paramSRP_user_pwd_freeSSL_get_srp_usernameSSL_is_serverSSL_get_shared_sigalgsSSL_get_sigalgsX509_ATTRIBUTE_countX509_ATTRIBUTE_get0_objectX509_ATTRIBUTE_get0_typeENGINE_ctrl_cmdENGINE_set_defaultENGINE_register_all_completeENGINE_ctrl_cmd_stringkillOSSL_trace_enabledOSSL_trace_beginOSSL_trace_endASN1_item_i2dASN1_item_i2d_biostrtoimaxX509_VERIFY_PARAM_set_auth_levelX509_VERIFY_PARAM_set_timeX509_VERIFY_PARAM_set_depthX509_VERIFY_PARAM_lookupX509_VERIFY_PARAM_set1X509_PURPOSE_get_by_snameX509_VERIFY_PARAM_set_purposeX509_VERIFY_PARAM_add0_policystrtoumaxSSL_get0_peernameSSL_get0_dane_authoritySSL_get0_dane_tlsaSSL_CONF_CTX_set_ssl_ctxSSL_CONF_cmdSSL_CONF_CTX_finishX509_STORE_add_crlX509_STORE_load_storeX509_STORE_load_fileX509_STORE_load_pathSSL_CTX_get_security_callbackSSL_CTX_set_security_callbackSSL_CTX_set0_security_ex_dataSSL_CTX_set_keylog_callbackSSL_get0_peer_CA_listgetpidBIO_ADDR_service_stringBIO_s_acceptSSL_shutdownUI_new_methodUI_ctrlUI_add_user_dataUI_add_input_stringUI_add_verify_stringUI_processUI_freeEVP_DigestEVP_DigestInit_ex2SRP_VBASE_get1_by_userEVP_sha512EVP_PKEY_asn1_find_strENGINE_get_pkey_asn1_meth_strrenameASN1_UTCTIME_newASN1_UTCTIME_set_stringASN1_GENERALIZEDTIME_newX509_NAME_newX509_NAME_get_entryX509_NAME_ENTRY_get_dataX509_NAME_ENTRY_get_objectASN1_PRINTABLE_typeASN1_UNIVERSALSTRING_to_stringX509_NAME_dupX509_NAME_get_index_by_OBJX509_NAME_add_entryASN1_TIME_diffX509_NAME_delete_entryX509_NAME_get_index_by_NIDASN1_STRING_cmpEVP_PKEY_missing_parametersEVP_PKEY_copy_parametersX509_REQ_check_private_keyEVP_PKEY_get_utf8_string_paramSSL_group_to_nameSSL_get_peer_signature_type_nidBIO_new_mem_bufPBEPARAM_itASN1_item_unpackPBEPARAM_freePBE2PARAM_itPBE2PARAM_freePBKDF2PARAM_itSCRYPT_PARAMS_itSCRYPT_PARAMS_freePKCS12_SAFEBAG_get_nidPKCS12_SAFEBAG_get0_safesPKCS12_SAFEBAG_get0_p8infPKCS8_pkey_get0_attrsPKCS12_SAFEBAG_get0_attrPKCS12_SAFEBAG_get_bag_nidPKCS12_SAFEBAG_get1_certPKCS12_SAFEBAG_get0_bag_typePKCS12_SAFEBAG_get0_bag_objPKCS12_decrypt_skeyPKCS12_SAFEBAG_get0_typePKCS12_SAFEBAG_get0_pkcs8X509_SIG_get0libssl.so.3libcrypto.so.3libc.so.6OPENSSL_3.4.0OPENSSL_3.2.0OPENSSL_3.0.0GLIBC_2.15GLIBC_2.4GLIBC_2.7GLIBC_2.33GLIBC_2.14GLIBC_2.34GLIBC_2.3GLIBC_2.2.5GLIBC_2.3.4OPENSSL_3.0.9OPENSSL_3.0.3OPENSSL_3.3.0OPENSSL_3.5.0                               @ /p· -p܇ +p ćii ii  " -ii 8ui Bti N)+pZ#+p h .p v 0p  /p· -p܇ +pp[x[P[[[[8[0[[h[X[[8[0[([[(\ \P\\ \(\0\8\@\H\P\HX\`\h\p\x\\@\0\\\\\\h\\ \\\\\\`]]]] ](]x0]X8]P@]HH]@P]pX]h`]`h]p]x]8]] ]]]]]]H]@]]]X]p]]]^^^x^P ^ (^0^8^@^H^P^X^`^Hh^@p^8x^0^(^ ^^^^^^^^^^^^^^____ _(_0_8_@_H_P_X__\ __ _o _Z _[_Z _Q _([ _ _t _ `p[ ` `[ (` 8`[ @` P`\ X` h``\ p` `\ ` `] ` `H] ` `] ` `] ` `^ a a@^ a (a^ 0ak @a^ Ha Xa_ `a pah_ xa a_ a a_ a a@` a a` a a` a b a b  bpa b 0ba 8b+ Hba Pb `b0b hb0 xbpb b4 bb b@ bc bQ b@c b bc b. bc ba cc c c0d (cj 8c`d @c Pcd Xc hcd pcd]c@e c ce cf ce cr cf c c`f c c| d df d (df 0d @dHg Hd Xdg `d pdg xd d(h d dxh d dh d di d d`i d ei et ei e 0e 8eD Hej Pe `e`j he xej e ek e ePk e ek e ek e e8l e+ fl f6 fl (fD 8fm @fO Pfhm Xf hfm pf fm f f@n fZ fn fb fn fi fo f f8o g gXo g~ (go 0gaZ@go Hg Xg8p `g pgxp xgp gp g|gp gl g0q g|gpq g~gq g  hr h hXr h| 0hr 8h Hh Pho `hr hh xh(s hf hps h hs h hs h h@t h h h it i it (i 8iu @i Pi0u Xi hi pi i`u i iu i i i8 iu iA iv iJ iPv jR jv j^ (jv 0jh @jw Hj XjXw `jt pjw xj jw j} jw j j8x j jx j jx j ky k k@y k 0ky 8k Hky Pk `kz hk xk k{ kHz k kz k kz k k { k k k  lp{ l( l{ (l4 8l{ @l@ Pl| XlN hlX| plW l| l` l| l l(} lh l`} lt l} l| l} m m~ m (m@~ 0m @m~ Hm Xm~ `m pm xm m` m m m m m.m0 m mx m nȀ n n n 0n( 8n, Hn` Pn `n hn xn n< n8 nO np na n n ns n nЂ n o o o (o 8o @o Po Xo ho po o  o7 oD oX ob o{ o( o o o oP p p p (p 0p @px Hp Xp `p! ppЃ xp- p p9 pF pc pn p} p0 p p p qX q q q 0q 8q Hq! Pq! `q hq+! xq q9! q qG! q qS qY! q rw! r\ r_ (r 8rXy @r Pr@ Xrx hr! pr! r! r! rh r r rhnr! ru r! ru r su sЅ sv (s 0s! @s Hs`Xs8 `s! psh xs s s st s st s su s s0u sP totl t @t Ht " Pt" Xt&" `t9" htD" ptY" xti" t) t! t tw" t" t" t" u" u" 0u" Hu" `u" xu" u" u" u" u# u# v# v&# 8v0# vS v v vw! v\ v_ v! v v6q v v9# w@# w1i wY# (ws# 8w0 @wz# Pwp Xw6 hw pw# w w# w w} w# w w0 w# wh w# w x xЈ x (x# 0xo @x# Hx*l Xx `x[px# xx x# x x$ x$ x x xH x"$ xx x y y0$ y yX$ 0y 8y?$ HyJ$ Pyz$ `yP hyb$ xyl$ y y y#} yЊ y$ y y$ y$ y$ y@ y zF} z zh (z? 8z$ @zf Pz Xz hz pz|z zaZz$ zo z` z$ z z zȌ z$ z { {$ {$ ({% 0{OZ@{ H{h X{P `{% p{% x{8% { {@% {$ {K% { {T% { {c% {H {u% | |% |؎ |% 0| 8|% H|@ P|% `|` h| x|% | | | |`u | |u | | | |t | }t } }u (} 8}0u @}P P}oX}% h} } }w! }\ }_ }% }% } }% ~s# ~ ~1i (~ 0~6 @~ H~& X~& `~!& p~(& x~}~9& ~S& ~ ~ ~@ ~\& ~h ~c& ~ ~k&  u& z&  0& 8 H& Pe `& h x& &  S   w! \ _  (  0͡ 81i Hݡ Ps# ` h xXy 6    K 1 Ȁ& ؀? ! I 6q X e l ( 8 @ P`u X hu p   t  t  ȁu Ё 0u P o X  ( ` pw! x\ _ _     Ђ ؂ ¢  (  ͡ 1i 0ݢ 8s# HH P `x h x  Xy 6    ȃ& ؃& K : } P k  (r 8 @ P X ht p t  u  0u S   w! \ _ (x[ 8z @ P X h( p ͡ 1i ݡ s#   ȅXy Ѕ6    K 0 & (X 0Iw@x H-X `p x! I 6q X    І`u ؆ u    t  0t 8 Hu P `0u hP xo  S ЇX ؇ w! \ _ \ Σ  0( 8ۣ Hx P ` h xXy \  #  6  Ȉf ؈( ^     X (բ 8 @q P X hF} py- k% K   ȉȌ Љ}T r w ~@  (h 0_ @ H X ` p x `u  u    Њt ؊ t  u  0u P 0o8g H  w! \ _  ͡ ȋ1i ؋ݡ s#    Ť 8 ( 8Xy @6 P X h p   t  t  Ȍu Ќ 0u  w! \ (_ 0k%@Τ H X͡ `1i p xs# p | f   ЍXy ؍6    #  K 0 8i H7 Pe ` hH x@ _   P d]^ Ȏy% ؎n %  &    ( 8 @ѥ Px Xإ h p $      ȏ8 Џ h      ( 0 @t H Xt ` pu x 0u S А ؐ\ _  w! 1i ݡ 6 0 8o H@ P ` h_%x S%$ y> k%K ȑa ؑh  x   |  ( 8 @ P8 X hp p  æ  ٦   Ȓ В 8  &  ; s# (` 0 @ HQ XY ` pm x       Г ؓ 0  § ߧ `  0 8 H P ` h x v} 8 f `  ( Ȕ ؔ  t  t  u ( 80u @ P X h`u p u     0 ȕ6 ЕJ  _  | 0 R (^ 0u @ H X ` pŨ xި p  F}    Ж ؖŤ    " P ( 01 8D H PL ` hS x ^  n (  h ȗ ؗ       (t 8H @ש P X h p      " ȘP И x      ( 0 @h H X ` p x Xy  : U c K Й ؙF | )y  My  k 0 8 H P& ` h& xP H  Ǫ ݪ  s Ț ؚЂ       ( 8 @ P X h  p7 D X b { (  ț Л P      (x 0 @ H! XЃ `- p x9 F c n } 0  М ؜ X      0! 8! H P+! ` h9! x G!   Нw! ؝\ _ 1i     0P 8d Hx P ` h x s# 0 $ ( |P Ȟd ؞d f  6 d   (d 8 @& P X hP pK p #  d   ȟ Пe d f e X$ "e z$ ( a h k%K Im Pm  hm     _ 0 8 H P( `1 hL x  0  h t H D P       (Ť 8 @ P X0 h p m )y  My  k  K  S   Hh  ( 0 @ H X ` ph x    m       `u  u  0s 8 HЂ P ` h x          7 D X b { ( ( 8 @ PP X h p   x   ! Ѓ -  9 F c n } (0 0 @ H XX ` p x   ! !  +!  9!  G!     0t 8 Ht P `u h x0u P oaZ8  w! \ _ m ` (m 8 @e P Xl h p   t  t  u  0u  w! \ (_ 0m @m H X͡ `1i p xs#   Xy 6 d  @ K m aZm & p @ Pw! X\ h_ p m j  n >n )n Dn In l p !  u (gn 0u @xn Hu Xn `v pn xk%   8 n `  $ H @ aZ | n 0n 8 Hn P `n h xn  h        t  t  u ( 80u ` pw! x\ _ o (  o o  Ј  )o { ` j ;o 0 8@o H P`Go h xUo  co m vo  n  n  n  h   ( 8 @d P8 Xk%h` p H @ aZ o  o 8 o x o  o ( 0|@ Ho X8 `f px xLx  l  o  o X o  o  o  o 0o 8(z H8 Po `` h p x   6q p 'p  n ( ;p P ?p x Up  (ap 8 @fp P Xpp h@ p}p h  p p  lh  p  p @ p  p ( 0p @ Hp X8 `p pp xq p q  /q  ?q    ( 0 @P> H X `7 p= xP > S >  w! \ _  ͡ 1i 0Y 8 H> P `r h xXy 6q       ̃     ?  @? ( 8`? @P X h? p   `u  u    t  t  u  (0u 0P @oH X?  w! \ _  ?        h ( 8 @ P X h* p  @ > X@  @ C @ ѥ @ c L (A Q (PA 0 @A H XA `Z pA xe k  B  8B ~ hB  B  B    B  0  C 8 xH  P „ ` PC h _ x C  DŽ q ؄ x C {     ! ! !g (! 8!g @!6 P! X! h!+ p!gj !H !Mj !C !b !D !v !(D ! !XD !K !xD " " " (" 0"ۅ @" H" X"D `" p"D x" "E "' "8E "1 "xE "8 "? "[ "E "aZ#E #f #F #h 0#@F 8#d H#hF P# `#F h#x x#F #d]# # # # #s # #Ђ # # # $ $ $ ($ 8$ @$ P$ X$ h$  p$7 $D $X $b ${ $( $ $ $ $P $ $ % % % (%x 0% @% H%! X%Ѓ `%- p% x%9 %F %c %n %} %0 % % % %X % & & & & 0&! 8&! H& P&+! `& h&9! x& &G! & & & & &t & &t & &u & '0u @' P'w! X'\ h'_ p' '͡ '1i 'ݡ ' 'Xy ' '† '6 ' ' ' ( (t ( ((t 0( @(u H( X(0u (S (چ ( (w! (\ (_ ( (F (l ( (|) ) )G () 8)͡ @)1i P)@G X) h)Xy p)6 ) ) )hG ) ) ) )t ) )t ) )u * *0u *P (*o0* @* `*S p*G x* *w! *\ *_ *P *o* *G + +w! +\ (+_ 0+% @+G H+k%X+ H `+. p+PH x+5 +C +V +xH +c +H +y +I + +HI + ,xI , ,I , 0,ȇ 8, H,I P, `, J h, x," ,< ,K , ,e , ,XJ , ,J , ,J ,È -ֈ - -J (- 8- @-0 P-J X-F h-K p-b -@K -x -K - - - - -ԉ -K - - . .* .F (.V 0.q @. H. X. `.ϊ p.K x. .K . .͡ .1i .L . .Xy .6 .8L . /"/ /hL / 0/G 8/& H/L P/ `/L h/ x/ /o /5 /6q /Q / /w! /\ 0_ 0 0Xy (080o @0! P0 X0 h0 p0z 0 0͋ 0 0ߋ 0 0 0L 0 0M 0' 08M 16 1xM 1G (1M 01Y @1M H1h X1N `11 p1@N x1x 1 1 1 1Ҍ 1 1ь 1hN 1ߌ 1N 1l 2N 2 2 2 02N 82- H2O P2C `2Y h2w x2 2 2 2͍ 2(O 2ɍ 2XO 2u 2O 2v 2O 2؍ 3 3 3 (3 83 @3h P3P X30 h3@P p3 3 3 3t 3 3t 3 3u 3 30u 4S 4ʒ 4 (4w! 04\ @4_ H4 X4pP `4l p4 x4|4 4~4L 4 4P 4 4P 4 4Xy 46 5 5 5hG 5 05 85 H5t P5 `5t h5 x5u 5 50u 5P 5o5 5 5 5w! 5\ 6_ 6 6Xy (6 86P @6# P6 Q X6. h6@Q p69 6xQ 6@ 6K 6h 6p 6 6 6 66h 6 6 7S 07ϓ 87 H7w! P7\ `7_ h7 x7Ј 7 7͡ 7-7Q 7 7Q 7 7Q 7 7Xy 76 8R 8r 8 (8 88 @8! P8I X86q h8X p8Y| 8@+ 8_ 8(R 8 8 8 8`u 8 8u 8 8 9 9t 9 (9t 09 @9u H9 X90u `9P p9ox9 9 9 9w! 9\ 9_ 9 :Ј : :) : 0:9 8:! H:XR P:6q `:R h:u} x:R :o :@ : :Xy :6 :R :l :v : : :Lx ; ; ; (;K 8;Δ @;_ P;R X; h; p; ;t ; ;t ; ;u ; ;0u ; ; ; ;`u < <u <S (<S `<S p<PS x< <w! <\ <_ < <Ј < <Xy <6 <xS <r = = = = 0=`u 8= H=u P= `= h= x=t = =t = =u = =0u =_ =(R =! =I =6q >X >P >o(> 8>S `>S p>S x> >w! >\ >_ >P >o> > ?S ?S ? (?w! 0?\ @?_ H? X?T `? p?0T x? ?hT ? ?Xy ? ?T ?& ?T ?% ?T ?$ @(U @\ @HU @) 0@xU 8@ H@U P@P `@oh@ x@, @ @w! @\ @_ @\ @D @! @Q AĂ Aa Aբ (Ai 0AC @Aq HA\XA `A pAЈ xA A͡ A1i Aݡ A A A A A AXy A6 B BLx BǕ B 0BI 8Bo HBU PB[ `Bٕ hBYxBV B Bpm B BPV B B B B Bq B B1 C9 C CE (CA 8CU @C"PCb XC hCpV pC CV C Cl CԂ CV C C W C C{ C CXW D D D}(DW 0Dm @DW HDm XDX `D_ pD xD D D D`u D Du D D D Dt D Et E Eu E 0E0u `E pEw! xE\ E_ E E@X E EЈ Ee E E1i EŖ Es# F F6 Fd F 0F 8F HFXy PFK `FpX hF& xF F FX F F Fx[ F F. FX F: FY F*l G@Y G GxY (G 8G @G PG`u XG hGu pG G G Gt G Gt G Gu G G0u H Hw! H\ (H_ 0H @HЈ HH XH͡ `H1i pHݡ xHs# H* H Hx H H Hx[ HB H_ H H IX I IxY I 0IXy 8I6 HI PI `I hI& xI& IK IX If IY Ik I Ip IY Ir I I J J Jt (J 8Jt @J PJu XJ hJ0u JJҥ J֥ JB J_ J# J J K K K 0K @K PK `K pK K K K K" KfK{%L%L% L%@L%XL%L%L%L%L%L%L%M%(M&@M&XM!&pM#M#MM`MMM`M@N@ Ny0N]&@Nf&PNo&`Nx&pN&N&N&N&N&N&N&NoN&O&O& O&0O'@O'PO"'`O0'pO>'OfO{%O%O%O%O OP P Pr 0Pbz@PlPPz`PpPL'PS P PH P| Ps Pt P P QӐ Q Q 0Q' @QS PQ `Q_ pQߑ QC Q Q= Q] Q>&QW Q QZ RS'RG& R 0RM&@RU&`R_pRY'Ra'Ri'Rq'Ry'R'R\dRedSnd(Swd@SdXS pSdSdSdSdSdS} TdTd0TdHTd`TexT eTeTeTCm T% TeU&e U3e8U;ePUdhU" UrjUx}U}U}U}U}V}V} V}0V~@V}PV ~`V~pV V~V'~V6~VI~Vg~Vx~V~V~W~W W~0W~@W~PW~`W! pW~W W#W8 @hH h{ px}vȐ! АFؐq @C_(8 08XB `h< F  ȑo p( 1(`H P:Xx}i0vHK `Eؒ @ ?8S @pH`>hZ pvx+f `<ȓm Г0ؓ9u ' 7(\ 0>8`*X( `h5 4\ Ȕ/~1(| P8(@'H P Xx A Iؕ@ j 0p8p @|H h px`  Ȗn~ Жpؖ` `( 08X ``hx  0 ȗЗ ؗ hÎ 0 (`H̎ PpV X@xӎ a ێ pf ؘ k   8# @ H@h`p x  ș~Йй ؙ k%p (t 00T 8 X| `  h      bz  H P xl m ؛z   8 @ h p &  Ȝ/ М 8  (A 0 XJ ` S  Z  e  p  Ht PX@x @ @؞ @ @8 @H@h px@ɏ @ȟ֏ П؟@ @( 08@X `h@ @ Ƞ@& @3 (@H@ PX@xM @Z @ءh @v @8 @H@h px@ @Ȣ Тآ@ @(Ő 08@XӐ `h@ @ ȣ@ @ (@H( PX@x[ @[ @ؤ$ @9 @8> @H@hC px@= @ȥH Хإ@L @(S 08@XW `h@Z @_ Ȧ@c @k (@Hs PX@x| @ @ا @ @8 @H@h px@ @ȨƑ Шب@ґ @(ߑ 08@X `h@ @ ȩ@ @ (@H PX@x @' @ت/ @7 @8? @H@hG px@R @ȫ] Ыث@d @(k 08@Xr `h@y @ Ȭ@ @ (@H PX@x @ @ح @’ @`4w h    4w   Ȯ Ю 4w   ( 0 @t P\ ` h  @H PX` hpx q `   (0 8 @bzHS PlXz`h1&p| xs H ߑ  '  >& t   Ӑ   l G& l M&U&t l@Pd`Ddp   HdOdK SdXd_ Ce(WhW W(_ 0W8X@@XHxXPXXQe`_ hXp(YxhYyyyyyzz!z -z@ P^`5cp9z @zGzNz  Xz0gz@rzPz`zpzzzzz{lll &{04{@F{`X{pn{{{{{{{{|  | 9| R|0 k|@ }|P |` |p | | | | } } } -} ?} [} g}@ 7P F` Tp b w         " -0 >@ RP e` qp     Ā ؀     # 60 G@ `P u` p    ́ ہ    ' 7 O ^0 p@ P ` p ؟ ǂ    0  '/ 884@MHWPgXm`xhypx 8LN_qȎЎ؎58Pw{ >(P08@HP&X@`Ch^p`x )ȏ2Џ@؏Pb@P`YYYZZZZ Z(Z 0Z 8Z @Z HZ PZXZ`ZhZpZxZZZZZZZZZZZZZZ Z!Z"Z#[$[%[&[' [(([)0[*8[+@[,H[-P[.X[/`[0h[1p[2x[3[4[5[6[7[8[9[:[;[<[=[>[?[@[A[B[C\D\E\F\G \H(\I0\J8\K@\LH\MP\NX\O`\Ph\Qp\Rx\S\T\U\V\W\X\Y\Z\[\\\]\^\_\`\a\b\c]d]e]f]g ]h(]i0]j8]k@]lH]mP]nX]o`]ph]qp]rx]s]t]u]v]w]x]y]z]{]|]}]~]]]]]^^^^ ^(^0^8^@^H^P^X^`^h^p^x^^^^^^^^^^^^^^^^^____ _(_0_8_@_H_P_X_`_h_p_x_________________```` `(`0`8`@`H`P`X```h`p`x`````````````````aaaa a(a0a8a@aHaPaXa`ahapaxaaaaaaaaaaaaaaaaabbbb b(b 0b 8b @b Hb PbXb`bhbpbxbbbbbbbbbbbbbb b!b"b#c$c%c&c' c((c)0c*8c+@c,Hc-Pc.Xc/`c0hc1pc2xc3c4c5c6c7c8c9c:c;c<c=c>c?c@cAcBcCdDdEdFdG dH(dI0dJ8dK@dLHdMPdNXdO`dPhdQpdRxdSdTdUdVdWdXdYdZd[d\d]d^d_d`dadbdcedeeefeg eh(ei0ej8ek@elHemPenXeo`epheqperxeseteuevewexeyeze{e|e}e~eeeeeffff f(f0f8f@fHfPfXf`fhfpfxfffffffffffffffffgggg g(g0g8g@gHgPgXg`ghgpgxggggggggggggggggghhhh h(h0h8h@hHhPhXh`hhhphxhhhhhhhhhhhhhhhhhiiii i(i0i8i@iHiPiXi`ihipixiiiiiiiiiiiiiiiiijjjj  j (j 0j 8j @jHjPjXj`jhjpjxjjjjjjjjjjjj j!j"j#j$j%k&k'k(k) k*(k+0k,8k-@k.Hk/Pk0Xk1`k2hk3pk4xk5k6k7k9k:k;k<k=k>k?k@kAkBkCkDkEkFlGlHlIlJ lK(lL0lM8lN@lOHlQPlRXlS`lThlUplVxlWlXlYlZl[l\l]l^l_l`lalblcldlelflgmhmimjmk ml(mm0mn8mo@mpHmqPmrXms`mthmupmvxmwmxmymzm|m}m~mmmmmmmmmmnnnn n(n0n8n@nHnPnXn`nhnpnxnnnnnnnnnnnnnnnnnoooo o(o0o8o@oHoPoXo`ohopoxooooooooooooooooopppp p(p0p8p@pHpPpXp`phpppxpppppppppppppppppqqqq q(q0q8q@qHqPqXq`qhqpqxqqqqqqqqqqqqqqqq q r r r r r(r0r8r@rHrPrXr`rhrprxrrrrrrr r!r"r#r$r%r&r'r(r)r*s+s,s-s. s/(s00s18s2@s3Hs4Ps5Xs6`s7hs8ps9xs:s;s<s=s>s?s@sAsBsCsDsEsFsGsHsIsJtKtLtMtN tO(tP0tQ8tR@tSHtTPtUXtV`tWhtXptYxtZt[t\t]t^t_t`tatbtctdtetftgthtitjukulumun uo(up0uq8ur@usHutPuuXuv`uwhuxpuyxuzu{u|u}u~uuuuuuuuuuuuvvvv v(v0v8v@vHvPvXv`vhvpvxvvvvvvvvvvvvvvvvvwwww w(w0w8w@wHwPwXw`whwpwxwwwwwwwwwwwwwwwwwxxxx x(x0x8x@xHxPxXx`xhxpxxxxxxxxxxxxxxxxxxxyyyy y(y0y8y@yHyPyXy`yhypyxyyyyyyyyyyyyyy y y y z zzz z(z0z8z@zHzPzXz`zhzpzxzzzzz z!z"z#z$z%z'z(z)z*z+z,z-{.{/{0{1 {2({30{48{5@{6H{7P{8X{9`{:h{;p{<x{={>{?{A{B{D{E{F{G{H{I{J{K{L{M{N{O|P|Q|R|S |T(|U0|V8|W@|XH|YP|ZX|[`|\h|]p|_x|a|b|c|d|e|f|g|h|i|j|k|l|m|n|o|p|q}r}s}t}u }v(}w0}x8}y@}zH}{P}|X}}`}~h}p}x}}}}}}}}}}}}}}}}}~~~~ ~(~0~8~@~H~P~X~`~h~p~x~~~~~~~~~~~~~~~~~ (08@HPX`hpx (08@HPX`hpxȀЀ؀ (08@HPX`hpx   ȁ Ё ؁ (08@HPX` h!p"x#$%&'()*+,Ȃ-Ђ.؂/01234567 8(90:8;@<H=P>X?`@hApBxCDEFGHIJKLȃMЃN؃OPQRSTUVW X(Y0Z8[@\H]P^X_``hapbxcdefghijklȄmЄn؄opqrstuvw x(y0z8{@|H}P~X`hpxȅЅ؅ (08@HPX`hpxȆІ؆ (08@HPX`hpxȇЇ؇ (08@HPX`hpxȈЈ؈ (08@HPX`hpx     ȉЉ؉ (08@H P!X"`#h$p%x&'(*+,-./0Ȋ1Њ2؊3456789:; <(=0>8?@@HAPBXC`DhEpFxGHIJKLMNOQȋRЋS؋TUVWXYZ[\ ](^0_8`@aHcPdXe`fhgphxijklmnopqrȌsЌt،uvwxyz{|} ~(08@HPX`hpxȍЍ؍ (0HHɏ HtH5Y %Y hhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhѿhh鱿h顿h鑿h避hqhah Qh Ah 1h !h hhhhѾhh鱾h顾h鑾h遾hqhahQhAh1h!hhhh h!ѽh"h#鱽h$顽h%鑽h&遽h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1Ѽh2h3鱼h4顼h5鑼h6遼h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAѻhBhC鱻hD须hE鑻hF遻hGqhHahIQhJAhK1hL!hMhNhOhPhQѺhRhS鱺hT顺hU鑺hV遺hWqhXahYQhZAh[1h\!h]h^h_h`haѹhbhc鱹hd项he鑹hf遹hgqhhahiQhjAhk1hl!hmhnhohphqѸhrhs鱸ht顸hu鑸hv選hwqhxahyQhzAh{1h|!h}h~hhhѷhh鱷h顷h鑷h遷hqhahQhAh1h!hhhhhѶhh鱶h顶h鑶h遶hqhahQhAh1h!hhhhhѵhh鱵h页h鑵h遵hqhahQhAh1h!hhhhhѴhh鱴h顴h鑴h遴hqhahQhAh1h!hhhhhѳhh鱳h顳h鑳h遳hqhahQhAh1h!hhhhhѲhh鱲h顲h鑲h遲hqhahQhAh1h!hhhhhѱhh鱱h顱h鑱h遱hqhahQhAh1h!hhhhhѰhh鱰h顰h鑰h遰hqhahQhAh1h!hhhhhѯhh鱯h顯h鑯h遯hqhah Qh Ah 1h !h hhhhѮhh鱮h顮h鑮h遮hqhahQhAh1h!hhhh h!ѭh"h#鱭h$顭h%鑭h&遭h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1Ѭh2h3鱬h4顬h5鑬h6遬h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAѫhBhC鱫hD顫hE鑫hF遫hGqhHahIQhJAhK1hL!hMhNhOhPhQѪhRhS鱪hT顪hU鑪hV遪hWqhXahYQhZAh[1h\!h]h^h_h`haѩhbhc鱩hd顩he鑩hf適hgqhhahiQhjAhk1hl!hmhnhohphqѨhrhs鱨ht顨hu鑨hv遨hwqhxahyQhzAh{1h|!h}h~hhhѧhh鱧h顧h鑧h遧hqhahQhAh1h!hhhhhѦhh鱦h顦h鑦h遦hqhahQhAh1h!hhhhhѥhh鱥h顥h鑥h遥hqhahQhAh1h!hhhhhѤhh鱤h顤h鑤h遤hqhahQhAh1h!hhhhhѣhh鱣h顣h鑣h遣hqhahQhAh1h!hhhhhѢhh鱢h顢h鑢h遢hqhahQhAh1h!hhhhhѡhh鱡h顡h鑡h遡hqhahQhAh1h!hhhhhѠhh鱠h顠h鑠h遠hqhahQhAh1h!hhhhhџhh鱟h顟h鑟h遟hqhah Qh Ah 1h !h hhhhўhh鱞h類h鑞h遞hqhahQhAh1h!hhhh h!ѝh"h#鱝h$顝h%鑝h&遝h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1ќh2h3鱜h4顜h5鑜h6遜h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAћhBhC鱛hD顛hE鑛hF遛hGqhHahIQhJAhK1hL!hMhNhOhPhQњhRhS鱚hT顚hU鑚hV遚hWqhXahYQhZAh[1h\!h]h^h_h`haљhbhc鱙hd顙he鑙hf遙hgqhhahiQhjAhk1hl!hmhnhohphqјhrhs鱘ht願hu鑘hv遘hwqhxahyQhzAh{1h|!h}h~hhhїhh鱗h顗h鑗h遗hqhahQ% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݿ D%տ D%Ϳ D%ſ D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݾ D%վ D%; D%ž D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݽ D%ս D%ͽ D%Ž D% D% D% D% D% D% D% D% D%} D%u D%m D%e D%] D%U D%M D%E D%= D%5 D%- D%% D% D% D% D% D% D% D% D% D%ݼ D%ռ D%ͼ D%ż DE1AWAVAUL-ATAUSHHXH=< dH%(HD$H1 HJ H=< H?  H? 1@vU$HHH H=\? 11H5 AH=?? ʥH=? L5c:L/HǪ1<LH=QA Ht1IH=7A [H5=HA H=I H=> çH=A H5uH=i> H@ )L聙HyH=? HtxH? H=V> aDi$H? H=yH? 襕Hv? HHtH5cL-1LHHtH5"eHHH=HHtH5L J1jHHt_H;轑IHf= H\Ht$HLt$HL3Eu(H H^gAHIELDH6gAH=_> H5@b;H=D> H5bH=)> H5*cuH=> H5?c:H=< H51A:H=< H=> [H5vH> H=; Et$5AL{H$.LcH5LH5CLD$ T$ ÅH5LH5LyH5LbtH5LGÅAH H$'H=; HVH)H1oEH HYeAIH$'H=: H HH)H1H5^HH5{cHH5^HH5^HuH5vaHH>H=9: 1H5ze8H: HH=H=9 wLH=ʘALcMEH5LqH5LUH5L>u AH$'H=9 H LH)H1HKlE&H$'H=8 H HH)H1*H=~Ƀ1H$'H=8 LH)HzH U1 1I^HHPTE11H= f.H=Y5 HR5 H9tH Ht H=)5 H5"5 H)HH?HHHtH HtfD= 5 u+UH=* Ht H= ɢd4 ]w1fUHSHޫHHSHt.Ht)w HryK`1~SdtIH[]f苗HH=5ì11Ҿg:萧H[]@HHHCXH[]@H1[]AVAUMATIUHSHtyHEHHtiMtdMt_DpPALaA9HSXHCdCd;C`|eHUHCX[IE]A\A]A^胖HH=4軫11Ҿg:舦1[]A\A]A^DHcCh[]A\IEA]A^f+HĻH=4c11Ҿ:0[1]A\A]A^DHH=L4#11Ҿi:1cfS趩Ht)@dHxXH讗HCX[sHH=3諪11Ҿg:x1[@AWAVAUIATIUHSHHdH%(HD$81 HHMMDpPHAtHgA9tLJ輔HEE1H=31Ҿ1:辤HD$8dH+%(HHD[]A\A]A^A_[HL?E1H=2萩1Ҿg1:]L蠢Aƃt0HI H5 LE1HIEAa1LHH1IĖIEHL==k=OHD$0zHHH;&E111HHįtx諷IHtk1ɺLHGLIH|$0LH|$HH|$YLآHТLH H|$0fDI}E1!=kHt$HHD$tLd$HkHD$ HD$(HD$0Lޠ;Hz1LRHL$0HT$(HHt$ cH|$(HR1Ht 8HԷH=\031Ҿ1: E12Ht$0HHD$0ڊH|$0H{0t)ѾH|$0HľHHyH{0Hs8HS@оHDI}H趯yHH@H{(HHH=v/M1Ҿ1:%111JHz1[HkH|$0tHCH|$0HFyH{HLoHgL?Ht$0HHL`HHLCx6HH=.n1Ҿ1:;FfDAUATIUHSHHHMHDkPAt]HEA9tPH{HtG11E1蛉HHtfLHH訒AH[D]A\A]@[HE1H=-萤1Ҿ1:]HD[]A\A]HE1H=q-H11Ҿg:HD[]A\A]ƎHoH='-1Ҿ1:˞ifDATL%g. A$uE1= bLA\@<-u= ~HHd|H=1. L  PA% H ,HPH5C15%, H fHH|H=- L ą PA! H u,HʱPH5BC15+ mH LA\AUIATIH5P,UHSHH=- dH%(H$1$M[HLH=T- H51,HHH+HD1MLH=- H5,H1H蔛H=, H5,11L%%@HH=, HH?9}tH=, L1F@H=, H5z1+H$dH+%(urH[]A\A]f.H=I, H5[+1fH=), H5+1 fDH= , H5*1AUMATIUHSHHHt$HtHLLH[]A\A]賋HteH=*H1Ҿg[:]1A\A]鮛ff.AVIAUIATUHHHI\HMtLL9u-HtHLH]A\A]A^@H1]A\A]A^f.AWAVAUIATMUHSHHL$HL$LD$ L$L|$dH%(HD$81豞HHMHMMHD$,CPm9eHD$SdI$IHC`~9CdHT|$,u]HD$HtSH;tMHHkHHD$oH|$HҺH;HHtH?H{HtrI$HHtjHt$ H|$xSH{ Ht lIHt4H{(HtVHT$HHtH{HHtD諜IHu:I<$藙I$I>H\$IH;HE1HD$8dH+%(HHL[]A\A]A^A_軈HԮ*H='1Ҿg1:E1H{HfHHLHH§H2I<$fHدHCXH/HD$8dH+%( HH11[]A\A]A^A_;H/H=D&1Ҿ1:E1HE1ŊHH AHA9wDHHHD$#H;LD$=uHt$0LbNH|$0谕+H|$01,HH+HHH5%&H[H=G%1Ҿ1:豆HʬoH=%1Ҿ1:趖E1fD1'HD$gHiH=$蟛1Ҿ1:lLD$I-HFWH=$e1Ҿ1:2HQ fAVAUIATIUHS֙HHDpPHAtGH/A9t:LL tH;HtLLH{H[]A\A]A^fD[H\H=#蓚1Ҿ1:`[1]A\A]A^DHH=|#S1Ҿg1: fDHH=D#H#1:끐ATSHL%% MA$iH5#L 4c;H5#LlrsH5#LAEta=Ȣ 'HH+rL APH "HPH59AT=@A|$rQAD$CH=$ ] HtH" VyAąH=Q HtH% cyAą8H=! HtH ;yAątLAHD[A\hfDA|$rA|$EfD= KE1HD[A\D= ~HHpL APH K!HЧPH58PH=" 1AH =1 ~HHpH=m" L f PAH HyPH58P1H =٠ 8HHH= HT$TuufDH= LH5P11E1E1E1E1L"LLA H= 0HL% ѐH|$pDL菗H|$hEL}LH譧H$dH+%(4HĘD[]A\A]A^A_ÐD$4#1D$@MMDL$@t51ɺrLWIHH3L+DL$@T$TH|$1ɾrDL$@IHMDL$@/1LwDL$DL$HI1E1E1D$HH=1 11D$8L5 @L= @H HD$L1E1E1E1E1L2L*LE1f.H= dHD$(HfH H= H51L%-#H=l H5HP0H=S L1HH荘Hu[D$TH  HD$ H HD$H5 Ha@H= 11蠽D$D$sH= 11pD$IED$RIE@M}Ll$ ZlHSH|$8mHHD$HH|H= H51H\$ D$Ll$ Ld$PfL+HLHI9uHD$XdH+%(0D$Hh[]A\A]A^A_DHL$HHT$8H5/*1H= 9~HH=yyLHD$ HL?|I‹LLT$xLcLLD$LD$LT$HICLL$(IcLIrLT$荒LT$HIH= IcHD$0A`H|$ HD$@HL|L޿8IHIA0foD$ LfoL$0foT$@LL$IAAIAQ 蘙LL$KHD$ HD$(HD$0HD$8HD$@HD$HD$AHL$DLLLl$ D$fH|$1L5IH肛MqHT$H= H5<1_vD11诽IHt`|H5gLcL[IHtcIvLHĺLqMv11UHD$HH5(H=) 1D$Ll$ H L1H5 H='nIv1LCL;qfH|$&qLHT$H= H5(YmLzHL$HD$D|lD$Ll$ H\$ H-"kLH51D$Ll$ HHT$8H5e'1D$Ll$ #H5H=  H51LL$IGH= H5HP 1H|$H׆D$Ll$ HT$8H5&1RD$Ll$ 諞HD$H z18H5 H=:&%mLL$H 1LH5 H=&lHD$1LHp艸Lt 1LLLT$ r1LLrH|$LT$LH|$HoHD$H 1LH5k H=%LT$zlLL$LT$ff.ATIUHSH0HL$HT$ dH%(HD$(1Ht$ H|$D$ HD$ HD$HD$vHtpHt$H輩txDd$ 1AHT$HtE11ɾH[HT$ HHE11ɾ3HE1~E1|$ AA 1E1 H5X 1訄H|$ >H|$$H̚H|$RHD$(dH+%(H0D[]A\f{rHHtIcH舦AątQE11HھH|HE1^fE1|$ HAA=H-AWAVAUATUSHH $HL-p f1LL5 E11HtdH%(H$1f$=HDŽ$DŽ$DŽ$HDŽ$5Ƅ$?DŽ$DŽ$HDŽ$HDŽ$HDŽ$HDŽ$HDŽ$)$@)$P)$`)$p)$L_D$\H$HD$pHD$DŽ$(HDŽ$HDŽ$HDŽ$HDŽ$DŽ$ DŽ$DŽ$DŽ$D$HDŽ$DŽ$$DŽ$D$(DŽ$HD$HDŽ$HDŽ$HD$HDŽ$HDŽ$HDŽ$HDŽ$HDŽ$HD$`HDŽ$HDŽ$HD$PHD$hHD$ HD$xHDŽ$HD$8HD$0HD$@Dr5|6wHcH>=DY=@ #w\uHD$A11HD$E1E1E1HD$ aH j -E$(H$AHI HD$/H1 H$@H$H= ^H$11E1H= 1E1E1H5TE1HD$HD$HD$ H= DnD$(H|$p1p1pH|$xHD$HtHhrH|$HyEBH$LMt1I~L%huI~RL7SLL'H|$0]H|$8SH|$ |HwHtL董H= 腣H|$@H$dH+%(rD$(HĨ[]A\A]A^A_fDD$\kD$HHc H H1H8H$0$,tHH8u$,A>H=8 2H511L蚥IH@L95 tH轭ADžRHtH1L製IH肕LH5[u}IH0HLL?cADžL5u LLBW-XADž]tHeHLHH H袽ADžH$.HDŽ$8DŽ$sHHL跼IHE 薔L$H|$fL5HLLvIHH$H*IHLf HD$1E11HD$E1HD$ @H) HD$hDŽ$H HD$H H$@H HD$`H DŽ$HD$P@DŽ$xHDŽ$_Ha H$D@H-I 4@L59 $@D$\H= 1ҾOHD$@L1E111rE1E1E1D$(HD$HD$HD$ $DŽ$H D$HH$@H DŽ$HD$Pd@Hi D$HH$D@H=I 1-H$ H=) 1 H$H=  1H$H H$@H H$@ DŽ$DŽ$z qD$(cDŽ$$PH|$0:H5M H|$0+HD$A11HD$E1E1E1HD$ [H|$8H5 H|$8{HD$A11HD$E1E1E1HD$ L% @H= H$Vof.Hi D$HHD$PGDŽ$ 0L=9 H5L芓HD$p H5Lj HD$p@H H$@H H$@H HD$ H HD$xH H$l@H=q 1UHH$FfDHI H$,@H$H! HD$H|$FH5wDLH51蟾f.MHD$A11HD$E1E1E1HD$ HD$11E1HD$E1HD$ fDHD$11E1HD$E1HD$ L=:L5sn LLLHH5H= LL1H5X1E1E1諽E1HD$HD$HD$ S7HD$11E1HD$E1E1HD$ HD$11E1HD$E1HD$ 蒙XHD$8HNHD$11E1HD$E1E1E1HD$ jHD$0HHD$11E1HD$E1E1E1HD$ 'kHHL蠴IHH5LPHDŽ$8H= H11H521E1E1%HD$HD$HD$ H|$ jE1H|$H\$$1L ^LD$@H|$ HsHHD$ fHH[nH|$ vH$$ $@$@;3H$$$1HDŽ$HjHLLLIH+A$'A4'$h$H0SHDFuH= 11AT$AE1H$H54HD$H|$\b|H5>HDŽ$L`HHDŽ$HDŽ$LHDŽ$HDŽ$HDŽ$HHH$@F0Ht$H{HWwD++@tERHHHC+@uH$I~HHD$(/jHHH$H=t HD$HD$HD$ H=g L1E1H5 E1HD$]H=6 AT$11H5 H$E1ưHD$HH =LH5 1H=O|$\H$Lu$I|$\J蓅IH11H1DŽ$HH$H$PL$ fIFHx^9IFHxIIH8Vu HHoIuHXW LH螇H辚H$11E1H= H5jHD$HD$LH$PL$H$c$%|$\H$Ht41HӎH$ IH4 |$\ H|$`D$H $$t(H$ $@ $D$(H$@H|$ PHH$Kb$ L$M H5L;t H$H5Z#L$uH$$H$|$H$M|$\R!H|$x"!HKHL;H HDŽ$D$H$L% ML$11E11AL8H5 LoHT$`1LH= #cg!H$9!H|$H$HD$H$H=] H5> 1$@,H$HH11qHt$xLHL$LL;tQLE1 H=} H51E1D$(HD$E1E1E1~E1vH=/ H51E1ΖYD$(E1]H$HcHL?3u HDŽ$H$HJHL3HDŽ$H= H511EHD$E1HT$hH=s 1E1H5WH=V H51H$H $H $xH= H5W11辕HD$@HD$2E1*L$E111LIHLT$H8H|$HLWH|$hLT$HHT$hHLLgctIH|$(H<NHD$H=] H51HT$hH=> H5mHD$Ll$HLd$`H\$pPLl$HLd$`H\$pD$D$3uHc AH HL8M1HH8uHHE11E1膁H=' H5;H1Ήb@1"AE11E10f.H= L1E1H5;A1E1jD$LV#H;H$8dH+%( HHD[]A\A]A^A_fD$D${AmDA]DAMDA=DH HD$ 'D$ADH- @D$D$LE1E117D$E1LP@16E1fHT$(H5 H= 4IHt1L{H>MHuH=" E1A.U1L|L MHtDT$EDL$EHD$ HtHL[-MtLLOLRIHjDD$HEqIŋt$1ۅH-L$ L5H=M H1L59DLNaHHtUHH!tH= HD$L1諆HT$H(D%= HH= H1HAЉH5[T$uOHt$0HaHH= H2bL59}wL`HHtߋL$t`H'H== H5HHH<HD1օH5mL44H5)L<L:H= 1E1LH5艅mIMH= DH51_H= H5GiH= H5,/QUDATMAȉHHH=M A\Bff.ATMAȉHHH=% A\Bff.ATIUHK11HHBu1H]A\@11H"t11HYtҾH MtLHpt1LHӁfATUSHtWL&HMt4HL%HLHaAE[]A\D=B _1[]A\=B ~HH L * AsPH HPIPH5PH= 1yH 1뤐HHL * AwPH <H IPH5PfD=1B \HHL i* A~PH HHPH5ATnDAUATUSHH.H IHH$HHH H5 sIHt=A zHL[]A\A]@=A HE1[L]A\A]fDHHH= L ) PAH 5HGPH51U2H @HHH=^ L UPA1H UHGH5AUH LH[]A\A]=@  )HL.PI%fDH5 H="]IHt5 tHLfxLL}deH=ݾ LE1== @HHQ H=& L & PAH HJDPH5J15r ~H @HH H=ξ L  PAH ]HCPH5BP1Z~H HH H= L d PAH HCPH5P1~H f=< CHH\ H=1 L *% PAH HUCPH5P1}H ff.AVAUIATL%@ USA$,[LLHt]H,t DB tEHb LH5` ]IHtpH(IHHtPkkHHtC^dL1HHPH51URyH hIH<1E1=18 L#DLbL/H*1fH8$HHD$=7 E1HD$dH+%(H(D[]A\A]A^A_Ã=7 ~HHH= L  PAQH kH=PH51UhxH HHH= L  PAH 'Hd=PH5tP1$xH LE111ۃ=7 HHcH=8 L 1 PAH H<PH5lP1wH =6 AoL qA=6 c1E1M1E1=l6 ;HHH= L  PA\H +Hh<PH51U(wH HHH=] L V PA}H H!<PH5I1AVvH UHALE1H= H0L  PH H;PH51UvH 1E1=5 PHHH= L  PAbH @H};PH5U1U=vH HHH=r L k PAH H6;PH5P1uH JXFAWAVL5e AUIHATIUSHH H,H9tSHHHHt?$LLLmIHtEHL[]A\A]A^A_3[H9uE1fUSHH)HtAHHtH>u H[]fDH}%H]H[]SH<XH=*11Ҿg:X%1@USHH)HtAHHtH)>u H[]fDH}_%H]H[]H,<YH=$)11Ҿg:$1@UHSH(HtIHHtHynHHt!H{ h%Hk H[]H1[]+Ht;H=c)11Ҿg:0$1ff.UHSH'HtIHHtHmHHt!H{($Hk(H[]H1[]H:H=(11Ҿg:#1ff.USHHN'HtAHHtHYL1ҾH= HgH= YHD$(HT$(Ht$01H5 LS L 'ZYHt$0LLH|$0AErHL$(1ҾXL3HUE12DLHYLHHD$02HALFA9|HH3IHGH}LIR=,, 61ɺiLr2H=, |Ht LLQH=5 H|H e H5V Hӳ2(IHAE1HE1}ALqA9DLFHD$0HEt1ҾL1ADžuHL$0=I+ H|$(fLE1%HD$8dH+%(~HHL[]A\A]A^A_=* H=L HtH=7 =* H5 HHHDupL= H ~H0HH=ȫ 1L  AWA$H5AWAW_kH Hu,HL=1H= AWH H0AAWL J H5AWHL$8HT$0kH=f H HT$HL$HtH=C =) @=) HH$H= L  PAH H/PH5P1}jH D@E1E12DHL$H Lt5 H= L5 IMtLdLHMLFLH]$ULL-L* zDLh2E_H= H5Y1iuDHH H=ީ L  PAH eH.PH515ʨ ]iH @L"=A( ?HHH=q L O PAH Hu.PH5eP1hH @HHYH=& L  PAH H*.PH5P1hH f=' LVfDHHH= L  PAH EH-PH5bP1BhH ==2' ~HHH=n L g PAH Hj-PH5"15R gH QHHMH=" L  PA1H 5 H-H5w5 gH 7ff.AWAVAUATUHSHHfom/L-֨ dH%(H$1HD$0)$fHD$(HD$ HDŽ$)$)$)$)$)$)$ )$0)$@)$P)$`)$p)$)$)$)$ )$0)$@D=) H= HDŽ$)$P)$`)$p)$)$)$EeHHL$0Ht$H1jjHD$8PLL$ Q H=i Ht!H5  H H>ADž H5 H= {H6H= = &1/IHbHH3LADž1{ / H= 4 >L5[ Mm Dˎ HLL= L LH} DLDT$LL$LL$IL T HKLHB H= XH= J= YPHL LPAHH5PP_H= H=} H=g O v=@ iHARLH=o PL LAHPH5P1NH (fH=  O= BHAqLH= H(L PHH5vPP1MH H= HtH=` e =k  H=] t=P t =K QH= t =4  D- Et = H=ݍ t = . H= t = a H= t =  = =  uXH= tN= ~EHA4LH=͌ HL PH_H5PHP1XLH =I W= t =6  = rH= H=ߊ = PHXLH=" PL A=HPH]H5P1KH H= L-x MHAZLH= HL PHH5PP1HKH 8H=?  H= t = I H= t = z = = = H=f = H(RALPH= L HPHH5-P1}JH L- Mt=] E1=Q _H=# xEHD$8HLt$@1AE1L1L=H5ֈ LN H׊ HtH= HL$8LH HtH= HL$8L#Ht$8HL$HADž H=N =q HL AWLPAH:H5PP@HA H@H A H(= ~HHtH=A L PAHH5d1RH QLH H E=    x{= 3HL WLRAH5sRHS P9H=M Eu H=2 = q= H=   HBADž= kPHGL LPAH H5PPH= + H=ψ eH=1 WH={ H=} H=g =R HARLH= PL ^AzH PH5tP1G  H HrARLH=: PL A0H PHuH5P1FH D E= QHAPH=݆ LPL A2Hm PHH5^P1fFH HVALPH= L jH& PHNH5P1FH = 8= HnQLH=7 PL AH PHH5P1EH H?HRA9LPH=҅ L Hl PHH5P1eEH H=A L=L #PHLH=| PL YA;H PHH5пP1EH H= = HQL &AWLPAH H5PPD¾"H>tD H>5=~  HL SLPAH H5aP5 !L- MtLH1IHHT$@HL LH|$@bH= H=DŽ H= H=˄ = HADž n HALH= HL PHH5ԶPP1KCH H=   H=-  = ~PH= HHdQH=2 LL (PAH5zP1RHBH H=^ P= CPHLH=т PL yAHdPH5PIfDH= LH 11j\IHHH4=  H57 H|$8E1Z7LH|$0H HH=  H H=  H HA&LH=Ձ HL PHgH5PHP1`AH )HALH= HL bPHH5vPHP1AH H= H5 H HADžyifHA*LH= H)L PHH5PH7P1@H HA,LH= HL PHLH5չPHP1E@H UHA.LH=p HL GPHH5PHP1?H "= HRL 'WLPA?HH5PP= RHL AWLPAVHyH5PPWHuH=~ H  H=Q PHLH= PL ^ARHPH5\P1?H H5 H_)H Hu[b f.+E1M111IHt^$HL-L HHIyH5ԌLHguHq8¾@LHE1111M3I#Mj= HAVLH=R~ PHȅL CA,AUHH5P1=H \H9AQH=~ LPL AHPHH5P1=H oHAPH=} LPL AHLPHtH5P1E=H >HASLH=q} PL NA(HPHH5=P1=D!=~#gwHcTH>@/wH5&e uHc H=e H57e1o%[1]A\1t[]A\a9y!6H4c ;e  LX[]A\fD6HDf {6He c6Hc K6H f o36Hc W6He ?6H< '5H, d f5H\d 5H4d 5H$d =d [5Hd C5H\b gNb Q5Hb ?5H$d '4Hb 4Hb 4Hc 4Hc 4Hc s4H|a [4Hla &c ifc Q4Hb ?4HDc '[  = qHHeH=:b L 3PA H `HPH5P1!H *D:b k3HTb S3HDb w>b a+3H$b O3Hb 72H_ 2Ha 2Hta 2Ha 2H_ 2Ha k2H^ S2H^ w;2H^ _#2H\_ G 2HL_ /1H<_ 1H,_ 1H4^ 1H$^ 1H^ ^ _ ] K1H` o31H` W1H_ ?1H_ '[ K ; = THHHH=_ L PAV H ]HPH5)P1H [0H` C0H_ g+0H_ O0H_ 7/H] SP w = dHHXH=-^ L &PA' H \HPH5P1H Z Z M/H\ q\ b-/H\ Q/H\ @ /H\ /.H\ tZ iZ ^Z SZ .HFZ >Z  "Z Z ;_ 轾Y r=.HY a,.HY P.HY ? .HY .-HY -HY -HY -HY -HY -HY -HY -HY q-HY `-HyY O-HpY s>-HgY b--H^Y Q茽VY A -HMY 0Z !,HZ ,HZ ,HZ ,HZ w\ ,HrZ  X i,HY = HHH=Z L RABH EYH5RHrP1BH fAWAVAUATUSHHX H5*X dH%(HD$H1H=kX HD$0D$,HIHD$8L|$,D$HD$Lt$0Ll$@D$HD$@H-X HD$8RHMMjHLLjUHt$(6H ŅT$^1H11H H|$0HD$07W 9D$meH|$0kLcHD$HdH+%(HX[]A\A]A^A_fDWD$H|$8hHl$@}tH5HH H5yWH=X Ht$8H|$8HHD$HH=V LL$H T$,Ht$0IcH|$觺D$,HD D$Ht$0H=DV H 3= JH|$@ H5VH|$8?Ht$0H=U H X31\HH٥H=W L PA H 5VH*-PH51t$X/H lfD1@AWAVAUATUSH8dH%(HD$(1HHH9IHHH11H5<Ll$ L=42DD$ G|$ HHH54L1vHK9#HHI~H=te=uL.H5L1f= CHD$(dH+%(zH8[]A\A]A^A_DL@HT$Ht$LHI8LL1Ht$ L|$t7I~t0LH5/\1E11LHLfH5̣L1Of.HIH5L1(1LLƷH== LHHXH2L= HH,H=T L PA* H SHm*PHH5P1~H uD=i fHH ̢H=T L BQA[ H (SH *t$0H5P1"H fHHyH=NT L GPAY H RH)PHH5SP1H fHH)H=S L PA0 H RHj)PHH5P1{H rff.fAWIAVIAUMATUSHH5VS H=WS dH%(HD$1H$Ht]t|H=ES LH51H<$E1xHD$dH+%(HL[]A\A]A^A_fH11LL$$HuH=R LH5oHL%HLLfDH=R I1H5@cfDATAHUHHWS +t uAuHHD]A\ff.@AWAVE1AUL-DATL%:USHH|$H|$A9}yDH|$D1 HA@HH=Q LIqH=Q LbH=Q LSH+9|H|$AA9|H[]A\A]A^A_DAVAUIATUSP IHtx1Z@LfE1ɹ1I11IHtHsHHt@LHt1HLtUL肿9|[L]A\A]A^fE11H54 LE1H1Ly[L]A\A]A^DE1AUIHATUHS1H!+HLHIh~$H9|H[]A\A]DH=9P LH51H=!P 謶H1[]A\A]ff.@ATUHH5SHtHI1HLHHP9|L[]A\f.[1]A\fAWAVAUIATUSHdH%(H$1HDŽ$HDŽ$HDŽ$HDŽ$ HDŽ$IHDŽ$H$DŽ$xDŽ$tDŽ$pDŽ$lMt HH$E11E1HD$(AHDŽ$HD$xHD$PHD$ HD$XHD$pHD$HD$HHD$hHDŽ$HDŽ$HD$HDŽ$HD$0HD$HD$`HD$8HD$@HDŽ$HDŽ$H=M kLH-H$߾H$"H|$hH|$HH|$xSHH$THUHLwH$ H|$0pH$H$Ht#H{wHH[H^#HuH|$PH-6MH|$能H|$pyH|$XoH|$ eH|$H$H$H$ĸLH|$H$eH|$`H|$@H$H|$8jH<$qHYH|$(rHGH$H$dH+%(%HD[]A\A]A^A_fDHK L1H# E1E1H$HHAH-'H0M KD$@HD$pHʙH$HDŽ$HD$xHDŽ$HDŽ$HDŽ$DŽ$XDŽ$DŽ$DDŽ$DŽ$@DŽ$(DŽ$HD$@HDŽ$HDŽ$HDŽ$HD$XHD$HD$ HD$(HD$HDŽ$8HDŽ$DŽ$4DŽ$0DŽ$,HD$8HD$PH$HDŽ$ HDŽ$HDŽ$HD$`HD$0HDŽ$HD$HHD$hHDŽ$HDŽ$HDŽ$HDŽ$HDŽ$@ӲP|QwHcDH>fD== =D=@ #wjufDHD$(E1AH$HD$PHD$ HD$XHD$pHD$HD$HD$0E1HD$HD$`HD$8HD$@=FH=H H$H =% =H{H HD$ HF HHD$8DŽ$(DŽ$P}AH|$PHtH$  H|$XH<H$F'HT$XH5G H=S薒qH$tH=G &訝HT$pH=G H5G1F1DŽ$DŽ$H= E1E1E1茶H$HD$(HD$PHD$ HD$XHD$pHD$HD$HD$0HD$HD$`HD$8HD$@HF H$8L5F H$4 H5F H$ 3$HD$0L )H|$HAH|$HAEHD$@Ht D98 |H5GIHML$PL$PHI@HE8I@HHD$@LD$@L@H5E AT@H$xH=E 1Ҿ0H$HlE HD$8H=[E H$lIy@H|$0tPM0H|$hH|$hLH|$HHt$0H|$H{E1HD HD$0HD HD$PHD H$H$H5D H$.fDHX7L$H$d$L$zH$p|DŽ$]DŽ$MDŽ$D=HC HD$`,DŽ$4DŽ$, DŽ$0HC H$ HC H$HC H$HC H$L$L$L$ L$L$tL$@gL$Zd$PL$CL$9L$ /L$%L$L$L$DŽ$ DŽ$ DŽ$ DŽ$ DŽ$HrB H$DŽ$ DŽ$}DŽ$mDŽ$]HB DŽ$HD$ADŽ$X1DŽ$!DŽ$DŽ$L$DŽ$HA H$HA HD$(H$H=wA 11H$HHRA H=[A H5:f.H)A H$TH$H= A >H$H$HH$H$ H|$xH=@ H$CHD$xHH$H$H=@ &$H=^@ EH|$Mt^H|$hH|$hLHD$0HLEH|$HLl$0Ht$0H|$H茾HD$0L-? H? H$H? H$H|$8HtH$ Hc)? H*? $H,1H$"$%$P1H$0 HD$hH D$H` D$tD$ $ $ $9 $H|$(H|$(1试HD$(HH=> H5A1\GH$ѡ)$@@H? HD$X)y@E1H|$HHD$hHHD$(E1H$HD$PHD$ HD$XHD$pHD$HD$E1AHD$0HD$HD$`HD$8HD$@HD$HHnc@kHD$hH GKHD$HHC'HT$PH5< H=uL1ɺ1IHJ HLwHD$(E1L|$AH$HD$PHD$ HD$XHD$pH$HdDkH$HDDHxH$ $%$P D$tD$ H|$0IM H|$h H|$hLiH|$H HD$0H|$HHLEL<TH|$(tH|$(1耒HD$(HHD$0E1틄$%$\H|$`tH=^; H51$D$%D$PhD$PDŽ$xE?D$D$P$-H$Ht 11H$L  $H|$D$8HL1ɺ1藩HD$pH H|$  H|$ L11cHD$ HH|$0 HD$XL$HL$(1L J$lH|$0 HD$HH$$MD$%@@H$H$+HD$@H$HH|$H $pHH5+HE蘱HD$`HHt$`$p11LHHD$H|$PwH$8D$t1yHD$8H $= HD$P= $ $' $ $$ "$E$Pn$DL$HD$0D$H$1L$Ld$X D$L|$$H|$h葦9XH|$h H|$HIL11LHӦIHL$HL$(1Hߋ$lL 蒮IHH$H?H H[H-9+uD$LLLH$衡IH&HHD$HsH|LD$H|$0tHt$0LzjLE1tLE1٬LD$@LLOgL?DxTH}tH=6 H51:D$$u DŽ$tD$\E*D$$P1DH|$`ED$P4HT$8H55 H=̀D$@d$mH\$@H$H$11H$LsD$8H|$ t(H|$ L11蠤HD$ H9$$|$8$==H$HD$XHD$pHD$H5H=5 1E1AH$HD$PHD$D$PH$H|$xH$ ˆT$84H}HH\$@$HLNH}HHiLK1ɺ1WHHuHD$H\$@E1H$HD$PHD$ HD$XHD$pHD$HD$0E1AHD$HD$`HD$8HD$@MH|$hH=3 H5O1HD$(H=3 H5%HD$0H D$yH$H D$xHD$0]H==3 H51HD$xqH=3 H5YH5DL$PrLED$x1IHD$@HH D$\ET$$xH$L IH Hl$`Ht2H$վH5(H薪HD$8H$H H<$LH<$HH.H>H$|H= 2 H5IH=1 H51H=1 H5~HDŽ$ H}H$H D$xL'H=1 H51*HD$x@SHD$hH_/HH=F1 H5?1H1 H=%1 H5HH= 1 H51GH0 H=0 H5(HH=0 H51p H=0 H5MXL1ɺ1L蛟HD$XH@HD$pH|$08Ll$H|$\fH=I0 H5S1DD$LLLH${IHLd$XH$E1L|$L$ALD$fH=/ H5R1{HD$psHD$E1HD$(H$HD$PHD$ HD$XHD$pHD$XH|$0#HD$XHD$HD$0H==/ E1A迕H=#/ H5T1`H$E1kHD$HHLHD$@E1H5E1AӦH$HD$(HD$PHD$ HD$XHD$pHD$HD$HD$0HD$HD$`HD$8lHD$XH . H$Ht$H|$@HD$0IM)$$(-E1HD$E1H$D$4L$ $0H$$,ЭHD$PHHH5$@H$H|$PHD$`0H=Y- H51E1AHDŽ$ H$jH\$E1H\$@A/H=- H5!HD$(H|$ 0dH=, E1VH$HD$PHD$ HD$XHD$HD$LM, H$HT$H$H|$@HD$0I:H$H=K, H5ӵE1AH$HD$PHD$HD$0HD$HD$`HD$8 HD$PE1AHD$HD$0y1H=t:HHt-H1yHH|yHHQH|$8H1LE1LH$HD${$t==uyL$HT$@LH|$8ΉH=+ H51E1AHD$H=* 1E1E1H5AyHD$H5H=* 1VHD$E1AL$HT$@LH|$8蹯VH$HtH$H|$8H1H5H$HtH$H|$8H1H5H$HtH$H|$8H1H5ٴ$L$HT$@H|$8LH$PH ۲1H5J) H=sA^L$P}HD$PE1AHD$HD$0HD$8xHT$H=S) H5E1AHD$PHD$HD$0HD$HD$8%H=) H5E1HD$PAHD$HD$0HD$HD$`HD$8HD$E1AHD$0H$E1Ld$XH$E1L|$L$AHD$pH$H|$8LrH=6( E1辎H$HD$PHD$pHD$HD$H$E1E1AHD$PHD$HD$0HD$HD$`HD$8HT$`H=' H5E1A=H$HD$PHD$HD$0HD$HD$`lHD$pHD$ H=B' E1AčHD$ H$HD$PHD$pHD$ HD$XHD$H$E1HD$PHD$Ld$XH$E1L|$L$AHD$$Ld$XL|$L$H$D$uH<$= D$ Mf$- (HHcH>LHD$0HM 1H*Dl$HT$H$Ht$XHE8HD$0HH LID$HD$0$D$Dl$Ht$@1L `% L$HDH$@$IH;A@HD$01D$D$Lғ9;LPHHI MvMtA9.uD$HL$ HT$H|$0IHH1IHtMtIvH(twH$E1ɹ LAʅuDLIt2H$tLYE111H$HBtLt$0E1AHD$HD$0AE1Lt$0E1HD$0AHD$HD$xLt$0D$HtJVH1LjjjL$L$H$HD$PH HHDŽ$H$tNH$VH5IHU11IjILEHD$@ZYHD$t.HD$xiHD$E1AHD$0&$Ht$@1LzuH|$ tMttRHD$xE1AHD$HD$0HD$xE1AHD$HD$0H=n" H51AQ5" L$XDD$(H$H$H$H|$PעAZA[HD$0IT$Ht$8L聊HD$E1҅AE1F<EDL$LD$8LH$H$Ht$x蟥묋L$HT$8LH$$둋L$HT$8LH$~IH=n! H5a1E1 HD$tDD$HL$PLH$H|$`H5;ll$LD$8LHT$PH$H$A览HA%HHDEH= 1H5kMt&LLHHNH$DL1XIH$L$H$H$|H$ݩH=6 H5ڻH$MH$D$}L$HHD$0L-q LALLHE1H= H5$菷HD$HD$0T$H|$@跷HD$0IHD$xAHD$HD$xAHD$HD$0|DD$H4$1L$y%HD$E1AC$L$Ht$@1LrHD$0$tL$HD$E1A1X1HD$0U@AWE1AVL5 AUE1ATIUS1HdH%(H$1LLH$H\H-DŽ$DŽ$DŽ$Hy nD$THD$(IDŽ$DŽ$D$8D$|D$PD$$D$xD$ D$D$D$HD$pHD$hHD$`HD$HD$HHD$@HD$XHD$0f.;t'|wHcDH>fD1IH= L1E1H5[E11HD$H= AUĹH$ЄH؅LH|$H$dH+%(~ HD[]A\A]A^A_f.gHD$E1E11U@D$8D$TH AHD$pH AHD$`fH AHD$hyfH HD$@_D$xK\$P<@\$$,@CD$ f.CD$fCD$fH HD$HH= H$lfH HD$XH$H= lwfH HD$0_H$fDLE1E1E1觅1HD$H HD$H=1 /AD$fCD$fD$|H= H5H$H$HD$(lH5cHD$(Jf.A5DDŽ$ H|$HtH$9uv$H|$0H QĈHHHD$E1E~H|$@H|$H4$H|$@H 1qIH$H|$H11E1L ן見HE1HLHH$HD$0xLI褁H|$0jMHL膁L$x ALd$0D$ED|$@3DD9d$D9d$ D9d$$AD9DD9d$D9d$PxD9d$E9utH= H5M1bHZHbnH= H5H1:eD$LD$pL$THT$ht$8H|$`聓HD$IH軨LHIH]IH=Ht$11H貉$H貛LHBIHH}HLI MHL7vLA謈EH= H518H=q 1H5&HyHHyHT$(H=> H.H=/ H5S`1H= H51H视HT$(H= HH= H5`1L5 L= HsH$LHL]IƃtH= H5 1@$H=z  LH5111ҾXHH=D H5I1MH=# H5ϬH= L@LHH= H5_1H薙H= H5.H@HT$H5_ H=s[Ld$0D|$@$H|$X1ɾwIHD$|iEX$HL2wH=C H5[H$H$H$HHHD$8چH$E1L5ǛH= H5H1$H\$HH\$8LIύU H= L9и:+E1H7$9ʋ\$HLqH=a H5Κ PH=I H5 11H$HqH$HcHRtE1F=l tHV HLhrH= H51E1~E1 eH= H5E1QH= H5ʙE16LE1{H5Ld$0E1 H=Q H5Ld$0E1aH=1 H51GH= H5p1E1*H51E1fDAWE1AVAUL-̇ ATLU1SHH8dH%(HD$(1D$$D$ #bH$HD$IsvAƅA"A|EFAwJcH>AwD[uAE1E1E11HWH_LvLmLzHD$(dH+%(`H8D[]A\A]A^A_ÐA=DHT$ H= bfH= LH5 1(SHY HD$HtcH5< HĊH H$HT$$kfDLE1E1E1/{E11DHHuE1E1E11AD1z)EE11薕IH%IH%M} IW(IEH$H$I?HBPMt%.HHIGL覉H IHIGD$Hxy9D$t$HH5nzHH$HD$HrH|$111rIHuC&@LxH0IHtLH$L $IL6rLxuH|$蠖L舒D$>T$$H<$1ɾr芙HHD$$=H= 1E1E1H5ӕAE1H= VpLqH|$LH= 1E1E1H5ЕA6H= pfE1AXE1AJAE1<111H]IM6E1E1E1A 1H莙ID$T$ H|$1ɾw\IHyD$ tS=t;D$E1H= H51AVH= *oLLD$LLوD$莘H$H=c H51H|$諔1蔐H$H=4 H541联1jnDATIH5USHoHHohHt []A\DH5RHQhHuWUHDPtHz H={ H#HHtkHSI<$H5 15AD$AD$t#I<$H5_1[H]A\usDI<$H5hU1AD$H{cHu3ff.fAWAVAUIATUHSHH(Lt$`LT$hEÃMLLT$tMLT$tLH5H1VLT$LH51H1=E~CEuL=0IL-^Et LH1H1LHL9uH(HH5ZT1[]A\A]A^A_fDMvLLH51qfDH([]A\A]A^A_eDLLT$EpLT$HHp.NML1f1ɀ8 HHI9uL |LT$H5eLLD$LL$ULL$LD$HLT$I1fDIHM9t,AHHI4 uI\HAA nM9uAAtjE~/AEL-}]LtfDLH1HI9uLHH5P1sH(L_[H5;]A\A]A^A_|H5HB녺|LT$H5XULT$HIt4A$SLLH5 1H=LD$bLD$LѺH5 1H=b% ff.fAWIAVAUATIUHSHHH$L$DD$H$HD$H$DL$L$HD$L$dH%(HD$81HD$ fD11Ҿ Leu11ҾLeuX HLyH== LH5ԏ1HT$8dH+%(HH[]A\A]A^A_@MH1ҾxHL$0L:eH|$01HT$(ɸL|$(I XH|$0HT$ H蝸HT$ AVHLt$LL$DD$(L$aX1ZM=Ht$ LD$H؎'D$fD1ҾxHL$0Ld$H|$0L!H5L1H5L11D$LcLl$ = 1ҾxHL$0LcHT$ H|$0HkHT$ IH=o H5(10|H5)LL|$ HHI{H=# H5̡ HLݏHcиHT$ X|H5L诹HHtnHH= H5\5H= H5I<H QLH5 1H=8#_yH MLH5 1H=^DAWAVAUATIUHSLHHL$H$HHt$(DD$ H|$ L$HD$L$dH%(HD$81HD$0HD$(HD$ qiMHLD$(HL$ 1HL|$0L XÃH=i H51L%ۋLLOwHt$(H|$ LHD$8dH+%(HH[]A\A]A^A_LD$(HL$ LHHc$#^%H5L1E1qaLD$0|H5}LLD$rLD$HILD$(HL$ LLHVtdH=] H5=1f.H=9 LH5ˊսH5̊L1E1輽1DAVLL1jLL$ DD$L$HT$@XZDH= H51f[H= H5b1E1C8詍H XLH5 1H=?*\DAW|AVAUA ATUHH5SH(dH%(H$1HDŽ$DŽ$HD$(HXH}~YH$IHtLeL=s HgHDLH, 1E1BQD$0HD$lID$@D$pD$8D$`D$hHD$HHD$XHD$HD$PHD$HD$HD$ +etO|wHcH>==~ƉO/dufDHcY AHHT HH8HD$x~1LxHMuT$t~ktgH= L11H5E11E1AHD$HD$0 JxD$tD$Mt_MD$H$LZD$LH5| H=EH= LH501hHD$1E11HD$0AE1E1H= DT$8aDT$8H|$( L%LDT$8:L貆H|$LPrH|$0FcH$IfH!pHɯH|$_H|$ULLrLMH|$ õDT$8H$dH+%(g H(D[]A\A]A^A_fD$hsD$hcL% T@H=i 1MD$l4@H|$tH5= H|$w ffDH|$\H5 H|$w6fDH HD$PL- @L-@H= H51cH H5H$DŽ$H$^H=q H5F1HD$1E11HD$0E1E1E1@LhgfDD$@H- D$p@H HD$H- @H HD$XD$`D$8D$8sD$0cH=y 1ҾDHD$ CH=Y H$GMzf.H) HD$HD$@H- H|$Hu L$@tT$01D$HED$ H$[HIݎHզIM HD$`D$*H|$Ht1DT$0fMDT$0HHD$O|$8#D$8t D$8H|$X1ɾwDT$`訅HD$0HH|$PDT$`IHD$p$DT$XGLD$ H11L $cmDT$XHDT$`HLH$PH%iD$XDT$`1DT$`ņDT$`HHH|$PH$E1E11Ht$PH$DT$`HDŽ$~1H|$DT$`t]H\$`DT$p7H|$$H$HH${H$dH|$_c9|H\$`DT$pHt$P11DT$`H$&H$H膡HDT$`MtEH$LDT$PW_H$LWHoDT$PHHHDŽ$D$XHDŽ$VH$HߋD$@H$DT$@H$H$H$IgDT$@E1H|$t^HH\$@DH\$EI/H赍H$HHD$PzHL$PHa9|H\$@LEH|$HD$@E1HD$P|$XE1St$lL$t HD$8HDT$Ha}DT$HHD$`HD$xD$pLd$xEHD$HcPILHt$hD$PPAUDD$X$H|$PpH tA11ҾLTD$pD$pHD$H9D$tHD$HlLHTHD$HT$XHgP$t$pD$XPAUUD$DD$h$H$Ht$XH|$`H0OPfˬHD$Hy賬HD$HHD$1E11HD$0AH= H51'H5o LDT$0άH5W L\DT$0HH҉D$8H= 1E11H5躰AHD$0cH= 11E1H5Q1芰AHT$HLTu{H= 1E1E1H51.LfLtH薁H|$ H|$H|$HD$HT$(dH+%(H8]A\A]A^L5KHT$HLSfmHHt(HT$ LHDtHT$LHDu$H= 1E1E1H5a.@HT$LHxDtHxIHtHE H=F H54w|IHt)Hi~Ht$LẄLH=2 H51Ԩ:yf.AWAVE1AUL-\\ ATLU1SH̻HHdH%(HD$81D$$HD$(D$ J=D$D$I$D$HD$HD$fD{Qtw|wHcH>=)=~ʉC<uE1E1E11"w6t QufHc AH HL(MO1HH8u7Ht$0LHHD$0HcЉH9.~kV:OED$H=r 1E1E1H5E11 JHT$ H=4 *=fH=) L1E1H5E1E11车H= AMHSsLOL\H|$(\LH詢HD$8dH+%(rHHD[]A\A]A^A_$@D$H=i 1Ҿ 3HDHI HD$H1 HD$HT$$fDLE1E1E1?UE11 Dd qd aAUDAEDA5DD$#D$1SQ<85ET$L%MHD$HtH=B H1H5&H H= L;xLH5!IHH5 HFMc LaD\$LEqgH5aBLLE1E1@HD$(HHLwH|$(mIH2H|$(gZHD$(1ۋT$ H|$1ɾwsIH<$Rt$E1L$|$ H9vLHv;HEE11\fIHLH_LE1RT$$H|$1ɾrsHH]Hl$L%KLl$(L5u1H5:|$$LIDIEHE1jA1蕃AYAZHHHH*~u|$$u fA<$DHt|IHl$LZLd$(MDD$EH5LH5$_H|$(IHjE1E11Hl$lZA|$x11ҾHD_HL%@p6ZLH5 H=1-$H5DL%LLHD$(HHLLt$(LH5mH= 1E1E11菡LH5#{:D$LL/H= H5HmoLD1ID$AL%(H5gH=h 1E1E11 GH5ILuLt$(HD$(H H= LDIHH`:H= H5ʅ1蓠1ɺLH`LOH= H51ZE1H|$(H5Vn輆GH5H=v E1E1E1VH=\ 1E1E1H5e6^pH=7 H51ٟH= H51迟E1E1ff.@AWE1AVAUL-P ATLU1SHHdH%(H$1H;HDŽ$HDŽ$HDŽ$D$|D$xD$tH 3D$(D$ ID$8D$<D$,HD$HD$HD$0HD$ @ H;|PwHcH>HT$xH= 4ufDH= L1E1H5E1E1E1LL$LGLTH$wHH-mHH$<HcVH$=HNVH$dH+%(6HD[]A\A]A^A_f,E1E1E1@D$tF@1AKH$L<tDT$ EDd$(Ht$H$H$H|$AD d$,78H=X H5l1H$t$|L sH|$ I%TIMH55L:t$xH|$0DѷIH]DL$,Et%DD$ 11LHECnCL$8T$eH/Dt$ H fD t$(HfHEAHGjǃ|$x *H= E1> hH= HH5-f膗H= H5}1lHebH= H5fHH= H5|1.fAWE1AVL5E AULE1ATU1SHHHdH%(HD$81D$,D$(+H$HD$ID$@?Džt= l| wHcH>D?ADžuHc9 H: H L1MJ1HHH8uHL$H\$0LH7t^HD$0HcЉD$H9HL$x@HQHHHT$d7t(HD$0HT$HcAH9H= L1E1H5cE11蘕H= AfL賂LKLKH苑HD$8dH+%(HHD[]A\A]A^A_D(lg)_E1E11jfA $4fA%DH H$H= 1Ҿ!HDD$^ N H HD$HT$(H= *}DHT$,fLE1E1E1CE11D1B9D$A&H H= H54,gH5yIHD$='@H5 L#<=U LPH5>zt$LVH5SzkE~DLcGLH5L IMt$(H<$D0HH\E|$(T$EELH H= L6IHHp c T$H5LHIH|$(H1HE1jE11HE1ZY^@/Ht$0L3bHD$0HcЉD$H9u ILH5 H=t1'H5yH=! 1E11ő(t$,H|$E1L`H JI{LH5*T$H= 1H5xlH= H5s`1WH= 1'H5Sw6111LH;Q+EBD${LHE1sEhH=4 H5]x1֐9LH{'aHHE1!H= H5vx1菐H= H5$x1uAVIHAUIHATIUSL=,M11HLH?IHtHh;)HJHHAMt$LLLA@[D]A\A]A^DE1[]DA\A]A^fAVIAUIATIUS4fAl$I\$@,v^HDh IM9wM)I(:=lN KHH= 1L 'ATAf H /H\j(H5Cwj(,Ao$H ) AoL$) ID$  H M9v\I\$2fDM)I(wW)LLH=] B0H+MI@,t]HDh tVI9r[L]A\A]A^D=M Ao$) Ao\$) ID$  H M[]LA\A]A^ù)LLH= bB0H LH bff.AWIAVAUATUSHHL.<$dH%(HD$81Mt0H= 8H 'HH<H)L1|Hy H $XAu^fDEA9}PIcEl$IL,SL-e ALZ@H=K F@|H5xIHH= LMH' H NHtVvN=d> ~EHH5NH= L wHDHAn H5]{P1RHQL!H z LLm7H= H-W HFOHH8PJEAH=P H- d,HHHLH|$L- == L3IHH=W H-H HtHtHF_ HHL LH5 H|$HNlOŅ H= H-L }HVHHKO=׼ L-X KLx<Ņ D$D$9< L,$E111LE1)2L- HHD$A=  "t8=0< Q1H]HHL(L7HHHOH5t; HA1rL-J 1Ҿ%1Ҿ1Ҿ HHL,$A1L IHtH=Y 芗IHtL%# 1Mt/LH5x%HF H=G H5LHvIă=; NP1LE1UE1LL`DZYLHHLvL-F H- gDV EuH= H5 H= L5Zw5LpHnIHkeID$HH[AD$PHIHtLHPHL PL7H Hyq^_HH5lH5HdL=ո IML%LL5#H= HgH5IxIHt]Hy HtH%HH-L%LLL%)HdLH[nH= iH5 L= Ht(L7 H hLLy`L=· H=÷ HtF5@ LLgLFIHHL4L/L=p MtL$LH ,H=I HHH1IHHLcL H= MtIH HHgLw4IHzLHJLV*]H=_ H HtwLgLH11LgHI(HMtL#)HLHlHHHHA=)EH HLgH= LH11LgHIu'HMtLE#)H'LHlHdHHHA(EEH= L=p Htd5% LLcgL+IH H+HH Lp H{-L{L-L= MtL"LH)H= HtUH g11 +IHHw+HHL7H{b$L{LV$Lw H=P MtIH L HHfL2IHHHcL'H= L MtIH HHEL1IHHHL'H= H Ht~LBfLH11L,fHIQ%HMtL!!)HLHiH@HHHA&E!H=# H$ Ht~LeLpH11LeHI$HMtL )HyLHpiHHHHA&EH= L= Mm LeLL11LeHH9$IHtH )HHHhMt,H)HH;L!> La%H(HHtHA1H= H= I=43 AXHATH=h L aPAH HĉPH5l_P1sH H NH=DZ H=± H%=2 H= H= 8y=2 PHH=³ L PAH IHƈPH5aP1FsH Ht$LK&Ņ! H5 HwCL@ŅL,$A"Ly=1 APH>H= L PAH HoPH5gfP1rH HARH=Ʋ L PAH UH*PHdH5dP1KrH H HtT=41 HAQH=f L D PAH HʇPH:dH5dP1qH H=w t\=0 ~SHAAPH= L PAH HpPHcH5dP1qHZ H HJ HWH= L PAH =HPH5RdP1:qH 5ذ =!0 HQH=T L 2 PA H HPH5PdP1pH nHH@H= L PAH HqPH5\P1pH H @H5m 1H=@HUH= L |PAH -HPHrbH5CbP1#pH AHASH=R L 0PAH HPH&bH5WbP1oH H= HD$ HD$(HD$0 H-Ʈ HH5 HH4eHHHL$(HT$ HLLD$0yAƅtVH|$ WH|H5V H|$ H>u@U E1H|$ H|$(H|$0HL-m E1=- cAVH= L1SL A HcSH5cSnH )E1=- PL A LSH#H5DcSSH= 1\nL-խ H j=E- TL- E1RARH=s L1SL KAHSH5Yi5; m=( H AQA L 0LSHH5fiS5 H= 1E1mL-/ H HT$0Ht$(LeILt$(M=w, MH=r H5x=>H=O HH5k=E1=L- ACH=U HD$0H=6 H-9 L%* HLH _d11 IHJ H= t9H= t/H6LI5LH5t =+  HL$0LHLAƅL\$0Mk L- MP =D+  L\$dH\L\$HI LlHL\$w * L\$=k u^=[ LLhLt[LT$c8T$E1AH~LH|$0 L- H* H=« H5 d1dk=]* 1E1=I* aA AQLL SHـH5*bSSH-T Ht=H=7 tH5 HHDbHHtML% MPE1=) L ARA LSHXH5IaSS0E1E1L- AAPH= L1SL A H SH5bSLjH H4:RL LSA HH5bAUPH=b 1 jH 1AH5' LL,$AG_= H~`Ly1Ҿg1:FL(H{@L{@LtH H(X`HA( HXh=Ѧ  ( t# =  = ( N D= AHo Dt HHT$D$WD$HT$HHUDDwXIH:H{HR= L{H= = = =ϥ = uiH=ݧ H2H-RH5VHI5Ņ=*' ANHL `ATAPP5p HB눾H`HALaDLaHH@PLHy|1Ҿg1:=E& HAVH= L xPA=H H|PH5{XP1gH yULH6|1Ҿg1:^(Hl!lLHs{N1Ҿg1:.LH"{1Ҿd1:LHz1Ҿg1:PH=d L1SL <A H{SH5_SeH zL- H-6HLRIHH=/$ LH0Aƅ=$ `LD2H|$0zNL% M3Lt$0MHHLHH H=" LH#0Aƅ=1$ HA1H|$(H5" H|$0bZL-{ - L,$AIAE1LD%x=# kL APLA-SHDzH5e`SSASH=Ť L1SL h7A$ HzSH5k_ATTdH =D# HH0=.# jE1=# H5<4LE14AAUH=A L1SL 4 A HwySH5^ATcH AVL A LSHHyH5^SATH= 1cH [PH=ǣ L1SL A HySH5]SWcL%P H 0APH=| L1SL 6A HxSH5]AU cH f=! BL/=! L ( PA LSHVxH5\SAUPH= L1SL A H%xSH5-\AUbH E1LL H= HD$0t]LHt$0HQL- t=H|$0HH5p H/= ! L- E1= ~L 8 PA LSHwH5USSH5٠ H|$(Hy13H5 H|$0Hs1E12Ah={ Hf1L QA SLHvH5YPAU-H71L\$LH=x VL 4A HvSH5;YAUP1 aH L\$AJ= ;L- MtH50L1H|$0x= kASH= L1SL A H5vSH5VSw`H 1L PA LSHvH5TS5 {=; PH=u A 1SLL GHuSH5[TAS_L-x H = ATH=! L1SL 2A HouSH5US_H kWH= A 1SL 2LH6uSH5vWSx_L- H MiL\$0ML == PHH=p L NPAH H|tPH5lMP1^H PH_H=, L PAH H8tPH5LP1^H = !HQH= L PAH jHsPH5JP1g^H LHr1Ҿg1:H=  `H}RH=Q L JPAH ؜HUsPH5JP1]H KH9AWH= L PA8H HsPH5NP1]H m [=n PHH= L PA3H 0HrPH5%N1j,]H H[)H=HH4Q*LL,$)HtH&)HHHPLA1WVH= Ak1SL /LH`rSH5Y5z \H t=u PHH= L PAH 7HqPH5KP14\H eHoppL1Ҿg1: Lw qfAUIHATIUtQHt=HLHAHAątQAD]A\A]D{Q= E1]DA\A]fDHHH= L PA H EHboPH5P1B[H f.fHH=q H5q1[HfAWAVE1AUL- ATLU1SH,!HdH%(HD$x1HHD$pHD$hHD$`D$\D$XHL gD$@HD$8ID$LD$DD$HD$(D$,D$ HD$HD$H$HD$0HD$ [{*|wHcH>H= HT$\ ufDH= L11H5lE1E1E1YH= AkHLH|$pSLIE1rLFHUHl$hHtH,HHHYMHl$`HtHW.H[HH0MHD$xdH+%(HĈD[]A\A]A^A_1E1E1E1fD$ 1AH<$Ht$p\$(Ht$H|$HL$`HT$h[=H=| H51E1XHL$ht$\L H|$ IIMVt$XH|$0D sHH[MtLH5}L<HD$8HtHH5A)Lu<qDT$@E1H5?L> DL$ Et%DD$(11LHEd(dL$LE1T$,E1|$XH)H=V L-LEH51VD$DH $u!D$(H$ D$HHEʃLLE1jH|$pIHtC:1LH QH5, 1L L|$`MtLLLHHLE1\H= H5n1V@D$, HQ HD$0H9 HD$ H=! 1ҾHDH= HT$XDLE11E1E1E1DD$LcD$@SH! H$@L5 H52 L*"mDHa H52 HHD$8@H9 HD$H! HD$D$HD$(D$DD\$ EuiD$H D$Dt_Ht$H|$HL$`HT$ht|H= H51E1ZTHL$ht$\IL ӧH|$  I:Ht$H|$HL$`HT$h7tH=\ H5_1ASH=? 11E1H5*"E1E1S4H5LOH= H5jE1E1SH= 11E1H5!E1zSE1E11L1>IHH:>H= H5M1-SH=v H=e H5iE1E1SaH=G H5iE1E1RCH= 1E1E1H5RH= H5iE1E1RH=ޒ H51RNH=Ē H5]1E1cR"fATIUHHH=/ tUHt@6H= H%u(H6HLH5 H]1A\QDH]A\HuH;HLHDHHDH1]A\HHH5 QAWAVE1AUE1ATE1UH- SHHHHdH%(H$81D$|HDŽ$HDŽ$D$xD$D$ID$D$0D$D$8D$4HD$ HD$(H$@#K |wHcH>HT$xH=ܐ ufDH=ѐ LH581pP1E11E1E1E1H= 4AH<$DD$pLH$H$vL^=LV=LN=1L;H;HODD$H$8dH+%( HHD[]A\A]A^A_fD==#fD1D$<xDL$DD$IHt}LL1ILH4H;L0t [L]A\A]A^LGH5E1[L]A\A]A^Dc@HIHs[L]A\A]A^H iLH5 1H=_@ATUHSHH{HDPu []A\IHtH{ uL;=tHSH}H5C1oDEEtH}[H5$1]A\KDH}H516DEnf.AVD4AUAATIUSHFA9Hc1IcL~sE1I1fDkDHcLAt I I9t5B+IHDPuH=܃ H51~C[1]A\A]A^[]A\A]A^fH= H5[1KCRfDH= H5r[1Ic(C/AWAVAAUATIUSHxH.H5dH%(H$h1HDŽ$HDŽ$HHDŽ$#D$Ht,H5EH#AŅ D$H1fDA1L= H5LDLH" E1H@ 3D$hHD$ ID$@D$XDŽ$D$`D$TD$dDŽ$DŽ$D$PD$x HDŽ$HD$HD$8HD$HD$HD$pHDŽ$HD$0HD$(tN|wHcH>@=F g=GLD%z u1-DT$hEt DL$XEuD$hH$H)qH$H/ DŽ$DŽ$H|$0HtH$ H$ L$@E|$xOD$@Y AO D$xPDD$PE D$HD! DŽ$AL-I|L99IHzL|H9IHH|$ H|$1ɉھrHD$0H|$0 H|$ H$H 1HD$HD$HH|$81Dw&HHh $ L$H HD$0H\$HHD$8H$$E1 H$HHnHD$HH(DL$dH$EV H|$HT$hH$HH5 |$X' H$YH$D$8L$hHD$XH$UD$D$`PL$DD$P$H|$/_AXHcT$H$@HHT$S/HT$LcD$XH$HtL//L9t$YH$H|$H|$pD$t,H$7…H=} H5V1=H$$H$JH$H$CH5yH H$HHHD$H|$ [ S H=a} H5:V1=1D$PHD$HD$f=!=F7eD!@H=| LH5+1x<H=| LH5 |1XH\$Ld$HD$Lt$D$|$`H=7u 11E1H5ֿ14D$PHD$HD$HD$8HD$0+=DŽ$DŽ$T$xH=t H5C1]4H=oq HD$0}DŽ$D$TEAAہO&H$fHE$IH$aD$EDT$TE{Ht$HLHD$HH#HD$8H}$HD$TKH|$8HqHD$HHD$0H$H- L|$0HL.HH.H5as LH5Rs HzH .s H=7s L1H52aHT$0H5r H=VɽDHD$HD$HD$1E11HD$8D$Pf|$X1H=r H5K1Z2H$AHPH$PD$HL$H$H$]Y^H5H=Ur HD$xHD$1E1HD$HD$8D$P`H"HHn1H$HE$hT$Hq LM H=q HD$H HH|$ HYQHHD$@n HH1.HH=n H53H1.D$PzH\$@H$Hl$Xl$xHD$HD$uD$-H|$pHe(t$D$H=nn H5Z1H\$ .HD$1E1HD$HD$HD$ HD$8D$PL$TH$H$u>HSalted__H9$^H$T$hH$H;D$hH5H=m 11L-D$PHD$ fDH$L@H$Ht$0H|$8$H\$HH$H|$pH$H5Ҹ;H=m H5o,Dd$TH=l Et*H51,Dd$PuL.H5ܸ1k,D$PHH=l H5MK,D$P(HD$HD$D$P H$|$H|$pt H$HD$pDL$TLD$pH$HT$(H$H$HD$HD$%H$H5ǷHH=k 1+H=k VD$PSH5 H'H5k L|$1HD$HD$D$P H5 HI&H5Yk LD$H1E1HD$HD$D$PLK HH$D$$11҉D$X3H5aD$H5 H8&H5j HH$1H$3H5CHH HH5j 1H=:%/t$hH$HH5c~H|$`EH|$HH5uT$hH|$HH;D$hH5*H=i 11)D$THD$D$PmH gH5`i 1H=r`H=i H5Y11A)D$PHD$H5ڴD$PH5c1E1 B$H51IH$"D9ο H51E1S B$H51I1H$DD9ο E *1H5|$h~YD$hH$Ll$XL%>IHH˃HHD$@L1H诿H9\$@uHLLl$X H$!MtDLH5*A-HD$D$PH$HT$ HT$H H$k IfDAWIAVIHAUIATUSHI.IHPHT$ sT$ H~HDA;Hc۸, HfHkLHNH[]A\A]A^A_f.A;~A$HAOAIL%L@0A7HcHHI.A|AIH5g0ALcLHHuH LH5:f 1H=a~Lf.HOIL%L@0A7Hc"HHt I.fI>QL@I1fATUHSHHdH%(H$1H9t&H$dH+%(uTH[]A\HIHHLH1HsH{LuCfAWAVIAUAATUSHdH%(H$1= H5 I- IHHD$MMIIvH$Hu'*@HpIvIAHt>-uH$LDHA E1HIE1<D$ D$@G|wHcH>H$H=]d H5c1#$H=Ad HL|LtH|$*H$dH+%( $Hĸ[]A\A]A^A_fDD$ ABf.PcA9AMƃDBD$ H= $@H5ic L@H5Ic LHcb Hb HH3Hu'NHHsHHt)>-uH$H=b H5l<1H"HvHbD$$H\$$Dl$DDt$8Hl$Ld$(L|$0DH|$9D$$Qt$$H|$HIHHHLH5HH1!Ht$(HH HxLHuDl$ED\$DEDL$8EE111Ҿ HWE111Ҿ H;LcEHD$HHE1HHD$PDt$D$ Aƅu@H=T,HceU HfU L$荨E1E1E1D$ cA'AJD肩:A D(fDH=AU L1E1H5TE1E1H= U A襻1nLLLH|$0HH|$(H5BHD$8dH+%(AHHD[]A\A]A^A_L=V T@H=yT 1ҾH5DHYT HD$HAT HD$LE1E1E1_E1Ht$0L MHt$11HL$(ϮHbLE11LHٺH|$I.IHLD$='H[S H=\S LIHLpLL$ T$HL5IHH1E1E1t$0HT$@HLAZYH=S H5,H=R H5U"E1ALH=R 'H51eH=R H5j,1E1HlH=R H5-,1.R@AWE1AVAUL-ATUH-v SHHЦHD$6DsAEA w%KcDL>HT$H= R H51HT$H=Q 1AH5QQHD[]A\A]A^A_fAf.mAHE1AAAAAAuDAeD1IAEt3DH=P H5iHHHLHD1tHT$H=P H5N1UAWL=ýAVL5AUL-s ATLUH-SHHHdH%(HD$81HD$0ڤH$HD$IHD$HD$HD$ D$( .~BaHcH>DD$(fD=D=@JtH=O L1E1H5OE1E1E1DH=O 1AHt$HLDD$(FH|$0LDLLHHDH|$H2H<$H!H|$HDD$(HD$8dH+%(HHD[]A\A]A^A_@=EH<$zHHN H|$0L{H$H~fH|$tH~HWN H|$0H5Ω6HD$H8H)N HD$ H=N 1HHD$fH|$0H2H5M f!fH|$HHM H|$0LHD$HLE1E1E1诼E11E1f9QE1E1E1E1HcL AHL L4I6Hw1LHXHHuDD$,THL H=L 艬DD$,HICHDD$, IHGH|$0DD$,tAL H|$0H},IHAHL趵>L.DD$,|$(H|$ wDD$,1ɁIHH|$DD$,H|$|DD$ H5MDD$ HI`HT$1HLDD$ +DD$ D$(DD$ T$LLNDD$ D@HD$0HHIH=K H5K1= E1E1H=vK H5P1E1 E1E1H=IK H51E1 H=1K 輱LE11-Ht$LHHt;HH5L1 E1kH=J H51 =H=J H5K1g HT$H H5?J 1H=fbQff.USHHH>;H;H0HH[H]ff.@USHHH>ۤHH;HȤHHH[H]ff.@AWL=I AVL5I AUIATUHjI¸LLL$I,MtLHu]A\A]A^A_fHLH]A\A]A^A_`AWAVAUIH=ATUSHHZH=H IqH=I L11H5^L-=wH=H LH5L50wL L(L]9=LH5\J HHt HTtLIHtHLHrtH=oH H51H=ZH L蚛HHH=;H H5H1I DH,HHtH=H H5d1HWHHtH8t~H=!HHHtH8H=!wHHHH8t_H=$Q@H5 HL[]A\A]A^A_{H=\G Lm!1H xH5aH=/G L1H KH51H=G L;!1H H5a-@H=F HH51[]A\A]A^A_mDH=F LH51PH5F H=m_UHHt#~HH5F]H1 fH`HH]HDHHD1HHH5KUSHHH>軷HH;H訷HHH[H]ff.@AWL=E AVL5E AUIATUHI袴LLLI MtL蟱H'u]A\A]A^A_fHLH]A\A]A^A_`AWAVAUIH=ATUSHHZH=D IqH=D L11H5>L-sH=D LH5L5s[Ls LL=9=LH5HH;H؜HHH[H]ff.@AWL=A AVL5A AUIATUHzILLL脧ILMtLHL4]A\A]A^A_fDH]A\A]A^A_ff.@AWH=AVAUATUSHHMH=NA IH511L-qoL5zoH=@ LH5/LDLXL药9=L H5B HHt HDtLHIHtHLH"tH=@ H51IH=@ LʓH"HJH=k@ H5ÎH1A DHHHtH=5@ H51HHHtH8t~H="HHHtH8H=$H/HHH8t_H=T@H5 HL[]A\A]A^A_H=? L1H H5#aH=_? L1H {H51H=2? Lk1H NH5-@H= ? HH5#1[]A\A]A^A_ff.fUSHHH>H蓻H;HH耻HH[H]?ff.@AWL=K> AVL5J> AUIATUHIbLLLIMtL/Hu]A\A]A^A_fHL蕼H]A\A]A^A_AWH=AVAUATUSHfHMH== IH511L-kL5keH=~= LH5LGDLL 9=LH5 ? HHt HtLȺIHtHLH袨tH== H51H= = LJHHʹH=< H5CH1|> DH HHtH=< H51_HHHtH8t~H=MHŜHHtH8H='HHHH8t_H=Ԋ@H59 HL[]A\A]A^A_+H= < L1H (H5kaH=; Ln1H H5>v1H=; L1H ΉH5I-@H=; HH51[]A\A]A^A_ff.fATUHSHH>JH;I?LHt[]A\H}HH;HHԷ[H]HA\DAWL=: AVL5: AUIATUHʤI©LLL蔼I,MtLOHu]A\A]A^A_fHLH]A\A]A^A_AWHfAVAUATUSHH5}HXH=/: dH%(H$H1)D$)D$ )D$0)D$@)D$PHHUHHH=9 H5ňH1HJH蒶H=9 H5 H1ZHH~t HtHHOHDH=g9 H5V1HIHH8HH-6L5WL%f.I(I(HHWtAGƒt : tID$HL$`AGHT$wHLl$HHL$ LHT$(HD$0~vLD$L1H5֏T$1IcL>DH$HdH+%((HX[]A\A]A^A_HT$(H=8 H5@1fHT$ H=7 H5&1Ht$LtwHT$H=7 H5Ɔ1eHt$LtGHT$H=7 H515`HD$ H=l7 H5H1>fDH=I7 H5Z1fDHL$(H=$7 H514@USHHH>諚HóH;H蘚H谳HH[H]off.@AWL={6 AVL5z6 AUIATUHʧI蒥LLLtIMtLH7u]A\A]A^A_fHLŴH]A\A]A^A_AWH=AVAUATUSH薳HH=5 IH5411L-!dL5*dH=5 LH5/LwDLL=9LH5<7 HHt HtLIHtHLHtH=O5 H5΍1H=:5 LzHHHD$՘HHL$H= 5 H5VH16 2HHHtH=4 H521}HHHH8t0H=:gfH5i HL[]A\A]A^A_H=t4 L1H H5ӂ fDH=I4 HH5c1[]A\A]A^A_ff.fUSHHH>KHӰH;H8HHH[H]ff.@AWL=3 AVL53 AUIATUHI袢LLLI MtLH臵u]A\A]A^A_fHLձH]A\A]A^A_AWH=AVAUATUSH覰HH=3 IH5d11L-1aL5:aH=2 LH5LDLLM9LH5L4 HHt HtLIHtHLHtH=_2 H5ފ1 H=J2 L芅HHHD$uHHL$H=2 H5fH13 2H芔HHtH=1 H5B1HHHH8t0H=JwfH5 HL[]A\A]A^A_H=1 L1H H5fDH=Y1 HH5s1[]A\A]A^A_ff.fUSHHH>kHH;HXHЭHH[H]ff.@AWL=0 AVL50 AUIATUH*I貟LLLIMtLHgu]A\A]A^A_fHLH]A\A]A^A_AWH=AVL5~^AUL-e^ATUS1H覭H=/ H58IH-LLHL}9LH5|1 HHt HDtL8IHtHLHtHH=/ H5~HD$1,HT$H6H=_/ H5G1 H=J/ H5n}1H=5/ H5~1H= / H5~1H= / LKHSH˫H=. H5D}H1}0 H-HHtH8H=4 oHHHtH8H=}IHHHuH8tvH=#^fDH5ɫ HL[]A\A]A^A_K1LNHH=. L1H 3|H5v|JH=- L#1H |H5I|H=- LL|1H {H5|Tff.@USHHH>HCH;HH0HH[H]ff.@AWL=, AVL5, AUIATUHILLLI|MtLHLd]A\A]A^A_fDH]A\A]A^A_韡ff.@USHHH>HcH;HHPHH[H]ff.@AWL=, AVL5, AUIATUHjI2LLLDIMtLoHǒu]A\A]A^A_fHLeH]A\A]A^A_0AWH=AVL5YAUL-YATUS1H&H=o+ H58IH}L5D$ LL9LsH5, HHt H\tL谨IHtHLHtH=+ H51D$ H=* L-~H%H譧H=* H5&yH1u_, ?HHHtH=* H5x1BHjHHtH8H=x,HDHHH8teH=H59 LAD$ tH[]A\A]A^A_f.H=* HH5y1[]A\A]A^A_H=) L1H wH5=xuHH=) L@x1H wH5xH'UHH5ySHHt xHtH[]DE1HSH=>) H5&1EH[]DH=) H581fHHH^H5xHUSHHH>H胥H;HHpHH[H]/ff.@AWL=;( AVL5:( AUIATUHIRLLLTIMtL迬HWu]A\A]A^A_fHL腦H]A\A]A^A_逬AWH=AVL5VAUL-VATUS1HFH=' H58IHMLUD$ LL9LH5) HHt H|tLФIHtHLHtH='' H51D$ H= ' LMzH%HͣH=& H5FuH1( ?HHHtH=& H5u1bHHHtH8H=uLH褵HHH8teH=&H5 LaD$ tH[]A\A]A^A_f.H=!& HH5v1[]A\A]A^A_H=% L71H tH5]tHH=% L`t1H sH50th'USHHH>[HcH;HHHPHH[H]ff.@AWL=% AVL5% AUIATUH蚰I2LLLԪIMtL_Hu]A\A]A^A_fHLeH]A\A]A^A_ AWH=AVL5RAUL-RATUS1H&H=o$ H58IH|L5D$ LL9LsH5% HHt H,tL谡IHtHLH躇tH=$ H5|1D$ H=# L-wHH譠H=# H5&rH1u_% ?HHHtH=# H5q1BHJHHtH8H=q,H蔨HHH8teH=H5i LAD$ tH[]A\A]A^A_f.H=# HH5r1[]A\A]A^A_H=" L1H pH5=quHH=" L@q1H pH5qH'USHHH>;HCH;H(H0HH[H]ff.@AWL=! AVL5! AUIATUH芟ILLLI|MtLoH'u]A\A]A^A_fHLEH]A\A]A^A_0AWH=AVL5OAUL-OATUS1HH=O! H58IH=LD$ L蠩LՏ9LSH5" HHt HtL萞IHtHLHʆtH= H5fy1D$ H= L tH腣H荝H= H5oH1U?" ?HߩHHtH=x H5n1"H:HHtH8H=n H褖HHH8teH=cH5Q L!D$ tH[]A\A]A^A_f.H= HH5o1[]A\A]A^A_}H= L1H mH5nUHH= L n1H mH5m('AWAVAUATAUSH(L=> dH%(HD$1HD$M1L5 NL- H= LLrHD$xH|$HZMM~8I0MtmA9utH= E|$utH5l1CH= INT$1I0H54nM~MuE=HD$dH+%(H([]A\A]A^A_f.L- $H= LLHD$H|$Hu^MLͥ薛HHuL]zHIVH5:1V軉fDfDMt[E1LH-N fDEw HA9DLH}8H0HuܸOADl$AD$fHD$dH+%(u^H= H(H5 k1[]A\A]A^A_DLHHhL`tHͬff.fUSHHH>HSH;HH@HH[H]ff.@ATIUHHjuH]A\fDHL蝚HH]A\ f.AWH=WAVAUATUSHfH%H= IH5k11L-IL5IeH=~ LH5TLGDLأL 9L苵H5  HHt H褾tLȘIHtHLHytH= H5s1H=  LJnHrHʗH= H5CiH1MDH59 HL[]A\A]A^A_H= HH5h1[]A\A]A^A_EDAWAVE1AUE1ATL%JUH-8 SHH0HdH%(H$1 nD$HH$D$DD$4D$8D$<D$@D$$D$,D$D$0D$(D$XD$`D$hD$pD$xƄ$D$|D$tD$lD$dD$\D$LD$TD$D$PD$ DŽ$D$莂fD#$HcH>L-qgH=? L1@H@@#H= H5,g1H= H= L%2g1LH= H5ti1wr@ @@@kL$4D$LT$D% ЋT$H% AĨH H=_ H5f1 H=J H5iaHHt5HyfHxH= HH1HHHuAH= H5f1H= H5li肳H= H5oioH= H5bi\H= H5UiIH= H5Gi6H=w H59i#H=d H5,iH=Q H5!iAEu)fDH$H=) 1AH5H$dH+%( HĸD[]A\A]A^A_fAf.Af.31AiL$D$PAT$TED  ȋL$L ЋT$\ ȋL$d ЋT$l ‰T$<kR D$<D$PH=苓IHH= H511L-=dH= LH5{LsDt$L@L=9 L軯L5< HMtHLHɨuHmH=^ H5HdH1HͿHH=6 LH1  kHHHtH= H5cc1HmHHtH8_ H=蘹H HHtH8f H=rH躈HHH8H=cH:cABD$A}D AcHE1ED$4A@D$ A-DD$ ADD$AD$ADŽ$DH AH4 D$HAD$8AD$<AD$,AD$XApD$`A`D$0APD$hA@D$(A0D$pA D$xAƄ$ADD$TAD$AD$dAD$DAD$@AD$$AD$|AD$tApD$\A`H= L= HYL5 I~8I0H?L臲uM~MILL ѕL5͕HudgL9L9u>L9t9:t4AG -H=~ H5waD1 L uL2IWIHtL9uH=A H55a1ApD$lA`D$LAPD$PA@t$D$D$D$PL-^LD$PL-^H= H5`1H-!iMHUH= H5`10HH=i L1bH=S L1H== H51bH=# H5B`1hH=  H5A`1.H= H5>`1H= H5B`1zH= L1iH= L1S^H= L1=D$tXD$PH=m L11H=_H1莒H=WH1~H=_HD$.D$t+D$PL-.]H= 1Lt$|D$ L-\H= 1D$PLtH=\xD$@|$D$tT$|$  D$ ЋT$x ȋL$p  ЋT$h ȋL$`  ЋT$X ȃ ̉D$LL$,D$D$D$PD`AD$@|$@Dd$PL-[H= 1LAq HEYzHH谀L$1H5L跿 $ H=b L1L$(D$LT$0% ȋL$ ЋT$,% ȋL$$ ЋT$@% ȋL$< ЋT$8%? ЉD$LŨurBB)D$AL-UH= 1LDOD$D$ ueD$@AH=W L1@@V@C@fDAl1L%HGDd$PL-UH= 1ALt$^D$D$D$AD$D$>AL-TH= 1L2-D$ ZD$@|$`L$(D$LA\$L-kTT$0% ȋL$ ЋT$,% ȋL$$ ЋT$@% ȋL$< ЋT$8%? ЉD$LŨa@A\$EhAL-SH= L11lIH HIH T$ 1ɾ{HHT$OHT$H11ɾ|L2HHc$LᾋLH LsE1HHHHtqD|$Dt$ILl$I͉\$ LfDL9LEH̞A0H= H5;UA H1D9I9uDt$Ll$\$ D|$L^L豌@=@ @@@I H=+ H5OR1H=虁IHt"1HH5}0L?H= H5R1L$4D$LT$D% ЋT$H% AĨ5PH= H5Q1.1g[D$f 1HSD|$1HD$ADt$ *fDHLH5#UL19\$襖I苑IaILt11LwA9}%DxHT$H\Ic耞HHP LDHvxcL%~ M=LL*ILLLH5PT1"H=9 LLH5 TDt$ D|$Ht$kHzEH= H5j1uL-OH= L1{@ @@  @@ H= H5O19@AL$4D$LT$D% ЋT$H% AĨBH=! H51R11LDt$#f.H= LH5Loo9LH$HI}H= H5cHI1O1HH$H55[gH$1o$o$HH$H5fc)$)$H$;gH$Ho$o$H$H5y$$H$(H$1o$o$H5PH$H)$0)$@H$PfH$Ho$o$H$H$x$X$heH$Ho$o$H$)$)$蛤HLHH$H$0t0$HVH= H5 PHLHD1bL H$X藏LzHHH8H=O%vH=Q H$H5}O1KH=/ H$H5MO1ѽLDt$_0H= H5L1袽ݴH= IH= L1{H= H5N1fH= H5M1LH= H5M12H=n H5M1s@@@L$4D$LT$D% ЋT$H% AĨAgf.D$PL-KH= 1L胼H= H5k7fDH= LH51HH= H51.H=j H1H5MYDŽ$H=J H5hJ1H=0 H5NJ1һH= 3H= 1H5@J誻MH$E1Dt$L$HD$MΉ\$ LHb[H|$LHb$H= H5PH1>$HZKH\KHEH=e 1H55LH I9uDt$\$ lH= FH=+ H5mI1E1L-K˺H$mH= LH1詺$MH= H5KH1腺AsA9DkkH$H$IH$H$L$m$dH$H=f L1$H0JH2JHEH=; H5 K1$色H= H5KH1H$HH= H5J1蛹D$D$PD$PH= H$H5K1P H= H5G16H=r LJ1H GH5G jH=M H5kG1Dt$ D|$H=) H5͸HHH$HI1HD$L$4D$LT$D% ЋT$H% AĨY?D$@AD$EA@CG`Dd$PD$D$PD`AA\$L-NFA /A\$L-&FL-FD@dA\$Eu.PD$gAD$EA+L-E|$A\$L$(D$LT$0% ȋL$ ЋT$,% ȋL$$ ЋT$@% ȋL$< ЋT$8%? ЉD$LŨAA\$E D$PD$D$ D$@|$AD$tT$|A$  D$ ЋT$x ȋL$p  ЋT$h ȋL$`  ЋT$X ȃ ̉D$LL$ND$LDHHtBHu}萒~2ImH[]A\A]A^A_@HLL҇HHuH= LH51BH= [HnH1[]A\A]A^A_DCqff.fAWAVAUL- ATLUSHxL= dH%(HD$h1HOHD$`HD$XD$THe HHD$8֮HH*D$,E1H(|D$(HD$0HD$@HD$H$HD$ HD$HD$f{\tw|wHcH>=1=~ʉCGuH$E1E11E1dwAt\u1A6aEtMVH H5qbLHD$HjHHHL$H1HL#HI~MSHt$HLcIMLLUhH|$0L|$`H== E1E11H5DٍH$\H= HT$TGzf.E1HT$8H= 11H5GE1E1{H$H zH= A9XLgL艞H|$X菫HZLZH|$UH<$SH5DpiH|$HD$hdH+%(HxD[]A\A]A^A_D$(D$,o Hq HD$@oH HD$WH= İHD$H6rzo !H5 Ho E@Hi HD$0|$,mL%F H9 H$H) HD$ H= 1Ҿ<HD$L0_HD$0H HHLIHH|L,TIHt{H= H51OIHt^I(L50xHAL-TPfDAw,AGIcL>MH4tH=O H1II(HuL!HE1E1E1pwE11H$efDL AH=MH =@L@H<wDL FH<_DH$E1E11HD$E1HD$H|$0L ; L$,MH|$`HT$Ht$0(L|$`MU1%fDHNLHI u~ZH\9|H\$@Ht$XHLHDL$,EH= H51wHT$8H= 11LH5PE1E1MH= !TH$H=} H5?!H=j SLMLUcD$,D$8H$Ht1HDH$HpH(HH11ҾH[OH|$rzpHIH11ҾH%ODk E H5 LT|$,Ht$0L-IHHHFx|$(2HtT$TMtL$8Ht$LT$TtNL$8Ht$ HtDE18^RHT$ H= H5+H1衫C@SD8,RHT$H= H5H1oT$THT$HLL9OI+H= L1E1H5=E1E10H$H=l E1E11H5An{H$E11yH=5 L1E1H5E11̪H$LE1E1AHt$011LsIH$D$T=tgu@LH茙MELL`5H5,LLCH= H5<12E1R1LE1t$HT$hE1HxrY^~\MLL辝E1nD$(11҃|$,LHtYi~8HWrD$(;H= H5^<蓅|$(uH= H5U<t{AWAVIAUATUSHxdH%(HD$h1~IlHD$XHD$PIHD$HHML= L1HDLE1H H-q=D$4HD$HD$HD$ HD$(HD$DQDž (| wHcDH>E11E1E1L=;LLT$L\$,LH|$jHr^H|$PhH|$nQL6H|$HLT`H== NHT$hdH+%(Hx[]A\A]A^A_HD$fHD$ fHT$H= 11H5JL=:}E1E1$fL1L=:VE1E1LLT$L\$7LH|$uH}]H|$PsH|$yPLAH|$HL__1 I 9 ID$4*fH HD$H HD$ H HD$(H= 1ҾU3IDD@@P#:@E11L=x9E1@FDeD5SfHc H HH(HbLPHMLT$8uDHt$`HGLT$8DHD$`HcAH9A(=@ak8+H|$Ht$PDHt$ 11HL$HI@@H|$(=IH1H|$XLHD$L  L H-qHL\$XLT$D E0H5 LLT$L\$:MH|$DeL\$LT$Ht$LLT$L\$t|LT$L\$LT$LLL\$=L\$LT$H5{t$4LLT$L\$~L\$LT$ DHLLT$L==7L\$L\$LT$HHs= HD$HHT$PL\$eWE1E11PHLLT$SZYLT$L\$f.1QAE11L=6HH5 1LT$H=1L=p6.LT$E1H=K 1@H5H=* H51L=&6ŢE1E1lLT$H55L\$H= 1蛢1L\$LT$L=55LH5$LT$L\$j;LT$L\$L\$H= H5rH5VE1E11PHLLT$jHHT$`LT$H5SL\$HD$`KH|$`L\$LT$HLT$L\$蛛H|$`HD$hLL$L\$LT$IMtHHtCH= HD$LHH541LT$ L\$LL$qLT$ L\$LL$LD$L=4LϺLT$LL\$LD$YH|$LYH|$` LT$L\$XH=U H5/41L\$LT$AVAUIATUHSHHLHIKH;Mt|H5LřIHLL1ILHAϏH;L4_t[L]A\A]A^@LJH53E1X[L]A\A]A^DcHIHk[L]A\A]A^H i*LH5 1H=>[@f.f.f.f.CH5hWff.AWAVAUL-ATLUSHXdH%(HD$H1HD$@&4| H5cI]HD$HHD$H-y2HHD$L=lJL5:D$HD$ HD$(HS.~BHcH>DD$fD=D=@tH= L1E1H5#E1E1E1TH= (ED$H|$H YH|$HwVH|$HeVH|$@fLjLjLQL@HD$HdH+%(D$HX[]A\A]A^A_@=E(H|$}HUH H|$@LHD$HH HD$(H HD$ gH|$@HRH5[ [>fH|$HNUH' H|$@LHD$HOLE1E1E1/LE1D$_+E1E1E1E1$H=JHc- H. H=g HHT H34BIH{HvIHH|$@tAw'uAE111BD1FfH=y L1E1H5A11 HdH[ALs^HD[]A\A]A^A_ÐL= ,@L5 @HE1E110G1@1ɺrLTgHH,1ɺwL4gHH"EWIHC艒IGHu0V 1H11譎IHHuEH=M LLH5kH=4 =111H\F1IHubDIΉL$ qHI>dH5`HHLUL`H5#bHH2ULHlL$ IL$ 3EL$ 9|;E1A-LHE1ZqH=n LL1H5jAH=M <9uHvHv)ff.fH6H?vHvH*Bf.AWAVAUE1ATUH@dH%(HD$81HHHIfAIL)$)D$HD$)D$ 1DIHI} tVIM(IUH=_ HH5i1Mu H5TELu}H=& H5B#1ȔHDAUAHD$8dH+%(UH@D]A\A]A^A_fDH}g1HtZHk$MHD$BH= LH5f^1HfH52^125DH},Ht"HP$MHD$HUHT$:nuZzouTDjA-uIHLLHT$BHtPHUH= 1AH55H蝓H= H5گ1AuHUH= H5;51Wcff.fH3mb 1H=PR SH=@R > tHH0HHxuH 0H5)H=:LH HHH5[H HHt4H=Q t*HQ fHH0DKH{H= uH[ÐH AWAVAUATUH-lSHH8dH%(HD$(1&Ig;ADžt`At:AuHE1yAHD$(dH+%(H8D[]A\A]A^A_H= LH51A貑Hc H HHHtV1HH8uuBH[HL$HD$HD$ 3HT$HAPf1?H=bP 1H-QP HEw @<9LH}8H0Hu޸OD$H=( L1E1H5[1L%O 軐H=O L- ueDE4$A9H51L$ D~L$ H= tnA΃IL$1LI0MI|$teDH= AN|$u1H5L$ A$L$ 9tP@AH5)e1AH=5 H=) H5D1ˏfDH= AOH5!e1A蜏H= .H= LH5Y1ArtD$'|_fDAWAVAUATUSHH $HH $HHL51E1LHXudH%(H$8 1HD$(HD$ #$D$ID$D$ D$D$HD$7 |wHcH>=}=~"uAE11H|$ L-X3LFL4LFHZH$8 dH+%(CHH D[]A\A]A^A_Í9z7*DHc AH HH;FE 3EH|$AD$bH|$1ɺr]HHHE1Ll$ f.LH@\ LH\$065HHt$(HLLAVD$L PD$PDL$(|$,]H uAZLH5WH= 1舌+D$D$H D$ HD$(ufuzfxffDE_D$AD@E?H AHD$ LE1E110;^fDfD$@D$1@ H3HP HHZZHT$ Ht$(LE1HLS AVD$PD$PDL$(|$,[H A}H|H5IHL$ L$ LHTVL% LH HD$ Ld$HDd$Ll$(D|$HIߋ\$ IHtTHL} EAVD$HLIPD$PZH uLd$A1LH5_VLd$D|$H1AH+E1K-ZH +H5 1H=(|H5豂IHFH *H5R 1H=yd( ff.@ATUHdH%(HD$1H$HtCIH]CLH$HHIYtH4$HSL$HD$dH+%(u H]A\#YAUATSHtVIHH5TLiuAD[A\A]LH}AŅtA[A\DA]E1[A\DA]@H= LH5NT1(fDAWAVAUATUSHH $HxfE1L-|E1H&odH%(H$h1H$p I)$` )$`DŽ$ DŽ$HDŽ$(HH$pHDŽ$ HHDŽ$=LLH$E1H-mH$H"H D$HD$PHD$HD$ DŽ$DŽ$DŽ$HDŽ$HDŽ$HDŽ$HDŽ$HD$pHDŽ$HDŽ$HDŽ$DŽ$DŽ$DŽ$D$(D$8HD$@D$`D$dD$XHDŽ$HDŽ$HD$HD$HHD$0HDŽ$HDŽ$HD$xHDŽ$HD$h/tG..|/wHcDH>fDH HD$@A.u1 4}HD$HT$PH= H51N1E1E1AH-PH$=H|$ RLQHr.H|$MHLX=H|$HF=H$(H1=H$ H=H$hdH+%(@HxD[]A\A]A^A_=~9HcH>ADD$=ufHD$9AHA H$$@HD$0HH HDŽ$HHD$HfDD$`D$`Ha HD$0HD$Hf.L1E1E12E1H-OHD$DŽ$pD$dcD$XSAGA7A'AAH HD$pH5 H$&H5 H$ H HD$H H$l@Hq H$T@HY HD$x?DŽ$(DŽ$ D$( $$D$(D$8#D$8D$(fDADDŽ$ H= 1Ҿ=HD$ sDŽ$`DŽ$PDŽ$@HI H$,@H1 H$@H H$@H H$@H H$@H H$@H H$@H HD$hH|$H5} H|$?[fDHY H$<@HA H$$H|$0HtH$pEH|$xtH= H|VH5U1H$tH=ٿ HSH5U1tH|$tH= H]0H5U1PD\$XE H$tH= H=H5rU1H$tH=Y HSH5KU1~H$tH=2 HSH5$U1~H$tH= H|SH5T1~D$EM D$E D$E H$tH= HTH5T1L~H|$tH= H/H5T1(~H$tH=f Hn/H5XT1~$G |$` |$`r $$ CvH= HPHH5S1}H|$ptH= H/H5S1{}L$86|$(? #\$(}$tH= H/H5S11}EtxH--H=> H$ u DŽ$ $u DŽ$H$H9$ HL$pH%HHEHD$pHD$Ht1HHD$H[H$EH$H$H$ H$(u&L$ MED$dLl$0D$HY E HDŽ$PDHDŽ$HHDŽ$@ DD E1 H|$xH$(L;F HE1ɺHDŽ$`jjjjjjH$PH$H@:1H53L$XM  1H$t+HL$H$1H$HL7RD$XIHD$L$LT$x$H$$H$(;HHGH$HH5 H= HL$h>IHxHL$hHT$xHH[1Lk7LXLHD$hbH;H|$hlpH+Ht$hH$PmbH|$hq+WH$t+HL$H$1H$PLQ[6 Lt$13L TH$PރHD$X THt$XH%L_(9|H$MHttHLA*$ttA11ҾXL)Dt$HEu8H$u|$(t&H$` HDD \$d/ HD$@Ht1HQnHD$@Hut$@HLP5 5 $PjD$hP$DPD$HL$H$H|$p%-H$XHH@HH|$pHtH$@vo |$(tH|$H$@H$ H1ɺLPDL$8D$gAXAY H$HHt`H$HE1rL-H$@$H$P(H$H(HV(H|$@lBH= @E1E1H- CrHD$HfDAj$:AAH$H9$HT$HH=1 H5L1vHT$0H5 H=RHD$@H$H$H$ H$(TL$()H$H$H$ H$(iEtH= H5L$vH=h H&H5K1vH=G H&H5K1uH=& Hk&H5K1uH= HHH5K1uuH= H H5K1u8H= HtH= H5d>HD$E1H= H?H5tK1uH=a H&H5SK1t-D$dH$`tDH?H@H$` D$HIHD$0H= H&H5J1tH=Ӵ HAIH5J1ntH= HIH5J1MtH= HHH5J1,tH=p H5bB1tH|$h1ɺrCIHH H5 3H$HHH$L*H$HH|$HGt$dDD$P$L$111H$X H$XHn H$P110H$PH->SQ=L Mt L/HxH->vH7fHD$Ha Hڲ Ht,HH|$HHu3HHD$,H-fipHT$@sH= H5:>OHH HYH|$H*A}H$u11f H$Lff E1H$$HH'H$H$HD$H$ HD$H15HD$(HsD$`Ll$8Lt$@D|$XL|$HHl$HHl$0H|$(c 9D$`H|$(t$`KHxIOu}D$PHLeIM1I݉.LKLL$MDHHL荛l L9|H5. LL4fD$`=H= ELH5cG11E1pE1H-U<_LjT$PIƅOH=ʰ H5C<1lp5H= H!H5F1KpmH= H!H5F1*pLH=n H!H5`F1 p`H$&H=; 1H5RGo&H$ D$XE11HD$@11H= H5p;1oIE HH@Hx#)H5WF11E1[oE1D|$dH-;H$(H|$hH$PL:+eH$PHT$hH5FE1Mu:H$PDHIH LH%)Tu.AH$PA9|GHD$hL9HD$x11H011HH$PDHHT$hH5FH= 111=nHD$@H=x 11E1H5JE1nHD$@XH=N 11E1H58H-9mD|$dH=# HH5D1mbE11D$XH= H59mEE1H-89pH$nZL$H$PH$0H$HH$8H$H11H$@*H=i H5}8 IH=V H$@ H$@,K=H$PHt HH= H57811lH$0HtfHcH$81HtfHcH=ͬ HH5E1llH$` H$`V1H$` H78H=n 11E1H56AH-7kH=B E1AH-71E1AH-~7A}HD$@1H$` H$`HT$8H= ufDH= L1E1H5AE14eH|$@LRaL1LrHD$HdH+%(HXD[]A\A]A^A_@1"H|$@AE1E1D$ 1!1T$<1ɾrL64IHtH5 H|$(FH= H5'?IHD$@1Mo|$<Ht$@11L@)IH=f H5 01M7T$8H|$1ɾw3IH'|$ ;H|$@ECD$|$8HL[H|$@E1cfD$H HD$L5 @HT$HA9}sDHt%LL!8".Hm/H5+LH{ L+H5R-LHa eLd$HDl$1Ld$H5Ln=HF9}?H;= ItH LLeEuLLULd$H|$@E1|1ff.AWL=CAVLE1AUE1ATUSHrHHdH%(H$1D$THDŽ$HD$xHD$pD$PHD$hHD$`HD$XND$DD$@ID$D$HD$ HD$(HD$HD$8HD$0fDc B|wHcH>H! H$HHT$HLt8H$HT$HHcȉD$DH9tH5 H=B1f.H=ٟ LH5@1Ar_1E1E1E11HLT$H-J,LH|$H$YLZ[LH+H|$xHhH|$pHVH$dH+%(Y HĨD[]A\A]A^A_f.=)=A"@it^f1 \tH|$tH|$H$nHt$ H|$(HL$pHT$x-YT$TH|$0rD1-HH2t$TEDD$ E$1H19$IM~L50HD$H4t$PH|$8xLT$HID$P=LLLT$+LLT$D$ADH) HD$8H HD$0H= 1ҾIDHT$PH=Ԝ jDHT$T֐LE1 D$@;H HD$ 'Hq HD$([D$fH=I PE111҉ƿo5H$H$fDH= PŅH H= L1H5'[fDH HD$WH= Ht$XH|$X+fDH=q Ht$`H|$`~fDH=A Ht$hw_H|$hNfDHD$h@HD$`HD$XD$H$H$q=1HwKHH"Ld$xMbLLHDIHL$xH|$0ML rbIHUHHD$y?LT$HIYt$PH|$8LT$uLT$HIeD$D$PLT$=CH=ߙ H5011YDl$LT$ H= H5'1[YH H= LH5w%9YH=} 11E1H5AE1YE1111HHH=< 11E1H5E1XDl$E1d111H-1I+1E1E1?H= H5>1LT$AXLT$|$@HD$pHL1E1PE11LLT$NY^LT$AH=| H5|$1E1AXH=^ LT$H=H H5$1E1AWH=* E1hH$HaLD$hMtLL$`MtHD$XHbL$Dt$E1A1LT$*LT$IMHl$pHuHLD$LT$HL$HLmALD$LT$HH,D$PLT$=H=S H51VLT$L$1ɾH#L"DMpH1LE1PE11LE1LT$ XZLT$*H=ؖ 1LT$1H5"E1pVH= DLT$1LLE11LT$H= 1E1E1H5"AVH=a E1HLE1fLT$LD$H$HX"LT$H|$!H|$LT$LD$H?LLE110LT$!%H=ʕ H5P 1E1AcUE1L$Dt$1҉LT$% LT$ILT$11ARPT$T A[]ILT$HLE18LT$LLT$(H=7 H5!1TH=" LT$^H= 1LT$1H5!TH= {LT$,LLT$'LT$f.AWE1AVAUL- ATLE1U1SHA<H(dH%(H$1HHDŽ$HDŽ$HDŽ$DŽ$DŽ$H D$LHD$8ID$HD$ D$ D$D$D$$HD$HD$HD$(HD$@HD$0K|wHcH>H=y H$guH=i L1E1H5˒E1E1RH=H AL%@L- H$ MHH-NLH$TH H$UH H$dH+%(!H(D[]A\A]A^A_jE1E1E15@D$s1Dd$D$ t*D$ u $tH=* H5 -1QD$L$ L$ ]H|$H$pH$D$ u$H= H5"-1SQ fDD$D$$Hi HD$@HQ HD$0H=9 1ҾHuDH HD$_H HD$(GH= H$jf.LE1E1E1E1zL= H5B. L:DHq H5- HHD$8 D$LD$HD$ sH HD$_D$ KA=DD$+11Dd$AH|$tH=ˏ H5*1mOHt$H|$(H$H$nD$$H$$H|$0L I2IM$H|$@#jIHHD$8L D$LE1 D$HD$ $=`D d$%T$LL6sfH= H5b)1[NXH|$0L II&H=~ E1E1E1H5gNH5L4HT$8HH|$P1H5H|$H$ HD$pMIoD$PoL$`L$H$H|$)$)$^LD$od$PHt$L#ol$`kHD$pHC yE1K\$D\$ H$H$EaAPE1E11PLLBAYAZD$ukE11LLE1HLIHtdD$$LD$Hte7u5H5L1L11LLIHvAA ULΉHLL$LL$9L $H= H51GEL $fDE1H$#HcHL$AăHHuL1L7;AăH|$M'|H5L=HHHD$LHLH(:E1AaH=ф H51sDE1AH= H51SDE1!H= H5 13DE1E1H=i H5R 1 DE1LΉHL $L $9LD$L1LLL $L $AH|$M'|H5̈́LfDH E1HD$8u1AFHD$H-HT$HH= 1E1H5G@HD$@HD$8E1E1E1HD$H= L\$HA&L\$HH|$@L\$H26H|$8h-H|$n1H|$(=vHL.H$wHH|$HxHH|$ =H|$3H|$0H$dH+%(HD[]A\A]A^A_D=~A 2HcTH>A fD=NHD$@E1E1E1HD$E1H- HD$8HD$]f.H~ HD$PwD$hcH=~ >HD$0HF[H~ H$,@Hq~ HD$ADD$XH=9~ 1ҾHD$(LE1E1E1OE1E1HD$@HD$H- HD$8HD$XfH} HD$xoH} H$T@AEDƄ$3Ƅ$#H=i} 1MD$l@H|$<H5=} H|$H=4} H5H|$ H5| H|$ fH$H=| of.H$fDH| HD$@?H| HD$`'Hi| HD$HQ| HD$pfDfDƄ$@fD fDH|$PDD$hH|$8D$hDD$lHT$HH5E$$$tuƄ$HD$@Ht1HAHD$@H AAAHD$AH-H|$@HEt E@ $$$D$hH|$PD$hHD$@ƒˆ$t$XL-bz H|$8`L|$8LY Ht$8H$L| HD$8H|$8L$h x@s B NH|$8r9<H|$`D$H|$8LE1H|$`DALDD$(L 11IIH LLILH*pLLIH=hy LH5H19LLHT$HH5H=9y 18E1E1E1E1HD$k4HD$H3HD$ Hu_HT$HH5H=x 1H-Wo8HD$H|$ H|$`tHT$HH5AuH|$`t$$$tAH|$8 AH=5x H5N1H-7HD$H|$8LLAEH|$ Lt$ LhAŅ~sE1\$PLDd$XEIHl$8 AE9tBDHHHIHT$HL1LH={w H5478\$PDd$XLH|$L|$LD$P1\$`Ll$8D$MMHx1IH;LLL(HL9\$PL:HIHuL$HD$XL1HL%1LLLD$X LHLD$X2LD$XHICH=Av H5 MHD$E1E1E1nQH|$8H|$H$dit|D$ht$|$hHD$@ L|$81L^ H$HsLf$UNDEsf$FdH|$PT$iHD$@HD$hiDH|$81H|$8HDžHD$(HWH3HD$8_LD$(HL$@1҉H|$L ؇HHD$A`H|$L1ɉAvHD$IH/H#LHHHl$A LD$(H|$11L kHHD$AHT$H1E1E1H=s H5E13E1HD$@HD$HD$8HD$\$`D$H|$p pH|$pAE1D$P BH|$x6H|$HT$HH5qH=*s 12HD$E1E1E1_H|$H5y+HT$HH=r H50E12HD$@LH5H|$8HT$HH=r H51J2E1Ht$8H|$@' uHM1jLL$H$HT$`H|$P^+A]A^CHT$HH=9r H5118HD$HdH$Ht$H$LHD$8L|$M/L[$Ht$(HtLiHD$8hHT$HH=q H51U1$ HT$HH5AH=zq H5WtAH-1HD$FHM1jLL$H$HT$`H|$P%A_Z"HT$HH5H|$x1ɺwmIHUD\$PEHD$H|$pHtIH5HH$H$HHD$HYH|$H\MD$h1H$H$L$tHH$IIt8HP1H$HH)H4<HD@>H$D L9u΀$iL$I@ NH$H$H$H|$8dH5LE1I E1L$1ɺrLLIMt#H$}uH$H=DNMHT$HH=-o L1H5 .HLHT$`H=n H51.H|$NHT$HH=n H5s HHH`HD1E1`.HD$@HT$HH=n H5 1H-1.H|$xwHIIHE1E1LyHT$8H=5n H5F 1-nH|$8HDž8ˁu@H|$uDH=m H5 1E1-E1HD$&H|$8H|$H|$wHHD$H5H|$8DT$hE+ APE1ELH$PH$PjHT$(Ht$`H E1ۅiH$$L$ $L\$HLLIL\$HH$HHHD$LL\$HHIDH;L\$H H|$8L|$81LsH$HxHLhH=cl H5(1,H=Il MŃtgH5WH=$l 1E1H5u+E1^HT$pHD$H1E1H=k H5-+L\$H2H5~H=k H56E1c+E1&L\$HHD$E1E1|$hD$lH$HcH$H$L$HD$HH5H$H$E1Ht$HLASL$L$H$H|$HL\$XZYL\$HH5% LE1zE11H=j L1E1@H5 R*E1H5(Il|$P$HE1MH$L$1HD$HLPjL$L$H|$H7^_~lH$H$HH uALLL\$H(L\$HH=i _L\$HE1L\$HH=i tyH5JRL$L\$HAQEL jj$L$HT$(Ht$`H |$P3$IH5L$L\$HjAWE1AVE1AUATE1UH-\SHHH(dH%(HD$1HD$VD$ IDžt=|wHcH>DADžuE1E:HD$HHT$ E1E11DuH|$E!HHH=g H1E1H5u'H5Hf.ADlAj@Hc g H g Lt$H-HH3H&H=Wg H51&fH=9g LH5f1A&H|$HD$dH+%(H(D[]A\A]A^A_fD$ +H=f 1A DHE1LHt$H=f WH|$11H @HHH0H=Kf HD1H%H3HEt0HHHЀ vHvHvT@JHF w@HJЀ vu L0HH=e 1AH5b%H=e H51H%qH=e H51A(%QH_H=_e H5U1%*H=Ee H5K$Off.@AWL=WAVLAUATL% U1SH8dH%(HD$(1HD$ hH$IDAƅABA|EFAwKcL>ffA'A~DVufE1E1fAhDXH=d LH51#fDH=c L1E1H5[cE1#H=c A`H5LHLHD$(dH+%(5H8D[]A\A]A^A_fDH=ic 1Ҿ HDHIc H$LE1E1E1ojf.Hcb Hb LM MZ1LHH8uLT$:H5WLLL$~YLL$E!E[OLL$LT$1HMEgIE*IDAuAMAGAKFLLT$A T$LL$8LL$HcT$HLT$AM Ht$ LJHT$ HHT$EtZHDHH9HHT$H=t6H=a H51q!@1HD$[CH<$1ɉھwIH%L|H5;b3IHH|$tZHD$AH=` LL9LF1LDl$*tLT$LLuD9 L)l$u{11Ҿ L(1fDA1LH $H5F H $H9L$HHD$E1:AT9LLT$T$LL$1HLL$HcT$A(LT$xH IH"LHIH=_ H5{1LLT$T$LL$HLL$HcT$ALT$nLLT$T$LL$wH_LL$HcT$ALT$4~H5zLqH H5^ 1H=v@AW7AVIAUIպHATAUHSH(HDL$ L ca A)Ɖ|$O$E11E1HD$h1L5HD$`HD$XHD$pHD$HD$PHD$0HD$8HD$@HD$ HD$(HD$HHD$HD$H=KT ֺH|$0H|$H|$pH|$HnH|$(L H$0H$(H$H|$8kH|$@H|$PWH$Ht1H{L-TH{RLSLHH$8臼H|$}H|$sH$ LHLH|$ H$GH$:H5H$H|$XLH|$`LH|$hLH$dH+%('$H[]A\A]A^A_@=5 ~3=pH=qR 1UT Rf.=D)=@6'f./ Ht$pU$8HQ H$HL$x1$ H|$H H$(蓱| HT$H5/Q H=E1@$kL5YQ MHH$L@0LH5P H=H#\ H=$Q 1E1H5P$HD$1E11HD$PL59HD$0HD$(HD$HD$qDŽ$DŽ$(HP H$t@HqP H$\@HYP H$D@HAP H$,@H|$XL5FL7H|$`GL%H|$hHLH$E11H$HH=O jjH$PL$H H$HD$XH$HD$`H$HD$hyH=yO 1]$YHL$xMDHL$x=DHL$x-DHDŽ$H$H$fDŽ$DŽ$HL$x DHL$xfHN H$@HE1ͽ$HyN HD$gL5aN =LTHZH$HpL4$H|$H H5 N H|$HfDHM HD$HM HD$0HM HD$(L-M @H=M 1u$qfk$WS$$@1E$)H)M H$@HM H$@L$0HuN MO L5L M% H$ LL$XLH$P1LH$GH$L$PHL$X LHLH$HH<$IMt*H|$ LtH$ L6HH=6L H51 $E1 fH}M H|$8苼H=K 11LNHD$8HzL$0MHMH$ Ht$8LLIHH|$ HH$ LWHH5GK L$#H=!K 1ɺ1Lz,IHH|$@H|$@Lwf.HJ H$@H=J H$H=J H$īwDŽ$4`HYJ H$D@HAJ H$,@H)J H$@DŽ$0DŽ$,HI H$ @HI H$@HI H$@HI H$@HI H$t@HqI H$\@HYI HD$GHAI HD$P/DŽ$DŽ$DŽ$DŽ$DDŽ$<HL$xH$ H'H=H H5-1E1g$HD$hE111HD$`E1L5HD$XHD$HD$PHD$0HD$8HD$@HD$(HD$HHD$HD$$H$ HD$MHD$(LLHID11HD$(HD$PHjH$11H$L8H|$0t%H|$011LBH$}H|$tH|$1>HD$H7HE1L1HDŽ$p1jjjjjjH$PHL$PH|$h>H@:1H5GL$hMH$H$H$1YHHHDH EH|$6L%rQ L811o'HcH |H5"GL4LHD$HHcH ~H|$H1wH-@jH3H&D?H EuI1L$h;-.H 1L-8DG EtL1H vHt$1f.D4$EsL5F MtH$HL'$ HD$PH D$H$HD$HH$1$$Ht$H=O HD$HHD$E1HD$PHD$01E1$1L5HD$(HD$UHD$@HSE1HD$1E11HD$PL5HD$0HD$(HD$HD$$L $ L $HH$  HN H=C H51tH=C H511ZQPH$0I{HD$HHY!#H$0IH$HD$Pu1H=AC 1E11H5{1L5w$HD$HD$0HD$(HD$$E11E1HD$1L5!HD$0HD$(HD$bH=B HD$1LH5DGH|$t?$H5TlH5[M H 1Kk$@ H$$b 1H$pH 1 HDŽ$xH$$tH$1ɉ1]H$xH$PDŽ$H$$H$H>111H$IIUH$PhHIH}DŽ$1HDŽ$Pzf$u}LK1LHIHH/LHu-H$HDŽ$HtL1H[H$PH8LP9xH$HM111rH$H1HDŽ$pHDŽ$xHDŽ$HDŽ$HDŽ$HDŽ$IHHeH$XH=IHLL$H$@H$pHx|H$XLHԳH$PD$HLEEHH+ H5ӼH$@E1L$`L$h1L$X$HD$$H$@L$`L$hHD$L$XlH$pHcH@t H$pnILcH ,L1hzHt$y1H 9LH5) H= B 蛂8tLIH 1zGH IlLH YHH5vHNL$XH=]Lm1$=Ht$pH&H=v) 111H5ML$`L$hL$X$HD$H$@E11L$`L$hL$XL$XH=ƺLL1LH x|$xE$H$L$$I$$:H=( H51"DŽ$H=L( H5w1$H=(( uH51.H5V1$fAWAVAUIATUH-y2 SHHhHT$L|$"dH%(HD$X1袒LH2 I萒LLLl$'IHt$ LL^)HD$MLHLYIwc)LHCLl)HL,H)LHHwJD%HD$/HH~E11H5ݰ1؞LpHh1HT$XdH+%(LHh[]A\A]A^A_HL蕊HmHwHl$護HHt1HHcLHHmMtTLiHLiILLHS3L4HL4HT$LHIH1LH豣LHLHT$LLLHLzL|$01LL#`DAv*fLHL$l9L$w؉LHKDEt2HL$H5HDL$u1LH茛D$LLiD$=UUUUiD$m۶=$I$D$LLS1LL>D$D$=`1LHD$D$JLHGE1LHwDHT$LL3LHL(LHH|$@LL$N1HAHcȃHHIL 0JH$)I9uD$5DD$;H5LL$LL$D$NIQMQDD$OA$OD_HHH?BBAHD$XdH+%(HhHH5x1[]A\A]HFHX~+BL%DLlLH1H\I9uHD$XdH+%(wHhHH5o1[]A\A](HFHX~BL%ԴLlLH1HL9uDH~I}HSLHIH(oPLD6H1LH5iL1H5nH~HD$XdH+%(Hh[]A\A]HFHT$XdH+%(uxHHHh1[H5]A\A]&fDHFHx0aH5HIH1HD$XdH+%(uHhL#[H5]A\A],7AWAVAUATUSHXt$HH|$(dH%(H$H1HD$hlxH\$(H觊H5mD$Ht$0! H=zILd$hL-mMHD$PL|$PHuKDL@LLHIHHL覝H9HBHt$(LZIHuLzH|$PD$|H5D(D$XHHHD$H$HH|$PBD$<D$\D$H/ t$H|$P衸L<$LD$0HaHL$(Ht$IIL1g9D$XkHt$pLV$%=.LHHHH=L5WH>t#IHWL9[I>HuH<$H5_D$8IH111L LHHH D$@KH1膷H8HHD$ L$蘪LD$ 1LH5w II8 D$ Mt&D$H'D$Ht$8t$qq8AH= HH IH51D$<DLt$LL軐H|$HD$HH5# HHHD$HH9cDpDT$8D\$ 8~H $H=E H IH5H1D$<D\$ DT$8}IT$HL$@H51H= D\$ DT$8 HT$@H= H51v+p8~IL$H= HA IH5ī1@D$<D\$ DT$8 1H5zHzH4$Lɻ0jHT$(H=@ H5٪1D$<5H= LH1H5OH5 H H= LH1H51D$<HT$(H= H5gH$D$<HxHtRHD$ L$7LD$ 1LH5 IIx:D$ >H=S H5D$<LLp|$ LLAAD$8D$<HT$H ߩH5 H=-t+H5 H HL$dLuD\$dHEt8|$ ALLA}D$@D$@D$8觥H=y HH51fDf.f.f.f.H5Rff.AVL5SAULATUSHHdH%(HD$1UiIf}Aąt4AA|AAwJcH>}1AąufHc H HHH } ?w]H;HH%H;AHusVfDA$?Db/E15f. &LE1HD$dH+%(HD[]A\A]A^ÐH= L1E1H5%nH覨HHtoL5P:7LfD$IHttH\$HHXHHt 1HAfHT$xH=D :gufDH=9 L1E1H5A1E1L袼LLzHH-H$H$HH$ḦH$dH+%(A HD[]A\A]A^A_=D=@C_fyfD1A~H|$H$$oD$$El$Ht$H|$ H$H$jH5ޝH= 1E1A1E1@=FDfD D$t @D$$@Ha HD$(HI HD$0D$$@H HD$ H HD$oH= 1Ҿ[IMDHT$|sfDLE1E11}E1H! HD$D$D$<D$D$8Ht$H|$ E1H$D$8H$ D$Ah9D$EtDT$Et$|$AH$H|$0ML &{袅HHH58HuH5HԳt$xH|$(DkIHsDL$Et$D$11HHE`蹞`t$<L$DT$8E1H=# H51D$xJ==  HHD$$$ D$eE11HT$H HIH$H'1LHH$H5 1LL$MtL5wLLH7y|$x fH|$@HT$tH5)$)$)$)$)$oL$@LoT$PHD$`H$)$H$)$i'LLE1[yH= H5A*H=s qOfD\$|AH|$0MDH$L r1HZH58 AA E1H1ynIHHuLD$蹷D$)uH= E1/qD|${DH$HH5IHDŽ$sLH5ݵ1 H$LLH5eX1H$ΧH=" E1E1ApE1AimH|$(E1H= hpD|$|$x S$ D$H,aHD$|$H HoHEE1H= H5E1E1AHE11HT$Hヌ軋HI耺HT$H=, 1AH5oH\$xrHHtǃ@ wHLE1if.$ D$HHD$H HHDE1.H= H5 (H=q n.HRHD$H=O H51AH5L1H= H51H= nD|$H= H51A|$Lt-&`E1|$Ltǒf艣XJH={ H5AJff.@AWE1AVAAUL-vATLU1SHζHxdH%(HD$h1D$\HD$`[D$0D$$ID$ D$D$HD$(HD$@HD$8HD$otg|wHcH>=!=~ʉsZu1AfwUtEou1D$HuttaXtADT$HsEjH=  H5"1fH= HT$\["fH= L11H5,fAE1E1E1E11E1LDT$L%|LL$vL~{H|$TH|$ʑHrn1LLb}2LLR}3LHB}DT$HD$hdH+%(HxD[]A\A]A^A_D$ CD$$3H- $@H HD$(ADD$fDD$fDHq HD$@HY HD$8H=A 1ҾPHD$L1^sE1vfDAeDD$APD$FfDD$03D$&fDD$AD$fDD$Ht 1HDT$HrZDT$HHHDT$HAAH|$(11Lq^rDT$HHI]HDT$(LIsDT$(DT$(M2H|$81ɺrlIHH|$@1ɺwHD$8ELL$8HHLLL$HL50|LLcC$LcD$8LLD$@mLD$@LL$HHDT$(IpL|LDT$@LL$(8LL$(DT$@HI T$8LLDT$@LL$(Ld$`LL$(DT$@t$0HHD$(t3Ht$(HHt&LIT5L:0HH@x@rH9u11LDT$8LL$0JeLL$0DT$8HIdD$DT$0LLL$<<K<htLL$t$L۔LL$jLD$(HT$`LLLLL$1]LL$DT$0;L$$HT$`D$ LL$LH߅]"kLL$E1FDAH= 1E1E1H5E1E11bE1ALD$t$\H1H|$(L wDT$HIXLD$t$\11H|$(L m*xDT$HI-E1E1E11AbLL$~Et$L蜓LL$~/LD$(HT$`LLLLL$趋LL$DT$0H=H51LL$zH=NfLL$AE1E1E1ALL$E1ALHDT$LL$誙LL$DT$H=QeLL$E1H=81LL$E1H5ҾLL$AsLL$DT$0t$LLL$DT$0dLL$LD$(HT$`LLLLL$fLL$DT$0;pLL$t$LLL$LD$(HT$`LLLLL$跍LL$DT$0&\AH LH51H=\DT$@LL$("H L1DT$@H5H=LL$(\DT$@LL$(Xf.AVAUIATEULSHD dH%(HD$1E-H ^1LHWZ{9} H=^ H辞IHH $ExDH9}QH=DH5Ȯ1蹼H5$Lu1HT$dH+%(bH[]A\A]A^fHLHB}H5ݨLt $H= 1LH5.,f  uV1lH=q IH5AMtm5_ H=H LH5~1ǻfH= H5N1諻1@H$H= H51臻2f= =H= H5ܬ1]#H H=H5141蘋AWAVIAUMATIUHSHH(H=X dH%(HD$1HYL53 tOL觳HHtBHtjezH9t`I$LHEIE0fE1L1HT$dH+%(;H([]A\A]A^A_MuH=uI<$|eHE뾐H= Ht$IHtoH54LnHD$HIHt%HT$LHTtHt$LuHH53Lr2H  H=H5k1茹LTtH5ڥLqfDH=H5=H5Lq菉ff.@AT1UHSH_HIt+H[M…!ЉC[1]A\fH= H5l1諸[1]A\@AWAVIAUEATIUSLH Ht$t3DKLDLH|$LWCH1[]A\A]A^A_DH= H51E1(EtSEAwH= K,LU҇EE|E9v$EtH=X H5Y觇DH=9 H50F與@AUATUSL$HH $L9uHAfHdH%(H$x1DfL$rH|$tfHHfD$pLl$p{DdHH1肦LCLHH= H~E腇H$xdH+%(uHĈ[]A\A]Jf.AWAVAUATUSH(L?H|$LHt$a|H5HHI迯HA?I1@~@|$M11C|$I!fAI@t8I6@DF uņxQ uIA$1IA?1@uɐuTLL)HL$L9HL$L)H([]A\A]A^A_LjH58nH(1[]A\A]A^A_LvH5mH(1[]A\A]A^A_1H nLH5`H= tTHuff.AWAVAUIATIUSHL7dH%(HD$1M HLD8HD= -D;HHHHv"tEH$L9t<诃 HDJ t*AmHuHDP u8I$ DHHT$dH+%(u"H[]A\A]A^A_fSHDP tʄf.AUIATUHH=Ht'H5o^lIHtyHLfrL辀Hfc=t]1A\A]H=YH51۳H=DLDŽ$AYufD1^H=bLH51H$AHD$ HD$XHD$PHD$E111HD$E1E1H=VH=6行H="蕌H|$H;|LXHeL賜H|$( xH|$0wH|$8wH\$H5yHkH9[H|$`_H<$HH5zgL"H|$ H_H|$_H|$E1H=H5GDt$p DH|$L$ H$H$L$ H$H|$H1H5AH$H$[IH$E11E1HD$ 1AHD$XHD$PHD$HD$H5?H=(CGLH uHH[H5DhI'cH蟏HD$HM H L|$H5LjWH=SH$H51$tH='H51ɞH$tH=H51詞H$tH=H51艞$H|$x,EA蕙HD$8H)}HD$0HeHD$(HH=[H5MlHD$ H;&f3MH21LIHmH5ML2VHHHN}HFjL=+HT$ H51wH=H51]H=H51CHDŽ$H$H5H=x"(}yL%9{H-ELHLHH$H l蓂L=LXEH5zH=0.L%zH-KH$H$LHG1HDŽ$H<$H$D$ 0< P:HgDIHH)H5vnHHcH9Ld+HFHHH$1H5KLQTHH1H諗IHHMThH<$HH]H<$OH HH$H<$ HxH$MH4$L Ht$`H/LLILWkLHH$UQMLxH5 H1H$`H$H$@H5GHH$H$` HH$`Lal) H$H= H-H=@e HLLtH$H' 1H|$(Hl$(u*4DH~tLHIPa}HH9|H52LzBD\$E L$p$LH4$腼HHLH$D$p$|H$蝴IH(H-L%wHH~HL\HH;i}nu}ou1}HE$H$D$1EHD$1H$HE1LE1$1HH$2a_AXK 5Dƒmt딋$H~L%L-vH-LDGLHL`H$H:hH=nH5S1D|$pEgH=FLH5l1L=nzH=e|H=H51詗bo}L%uH-FHLH蕏HD$XHJ rgHD$XH$ L%uH-FH„LHKHD$PH@ (gHD$PH$$HWHBH$H=2H5HD1ΖH$1L%tH-AEHLH躎H$H/fHhDT$pEH=1H5tXH$H=H5j14H$WH$H$HD$ HT$8$H BH|$xIH 1E1E1AHD$HD$eNAE11E1HD$ HD$HD$Ht$`H H<$DžA Ht$`I=HbH$E1H$H<$QH5H$A$0<  1LE1vHRHaL$$1H$H=H5;1L$踔H<$H5:MizH$E1HD$ H=LH5W1cHD$ E111HD$E1EHD$ E1HD$1E1AHD$RH${$D HHD$HDŽ$MM $$3L$E1L1A1LEH5LUH$HtH=LHLPH=HtLHLOjHL$0H$HL`]H$MHD$IH=:I1H5.ْxH|$H=H5H1詒H=LH5A舒H$HD$ H=H54_Y%xLH$E11HD$ E11E1HD$XAHD$PHD$HD$HT$BwHDŽ$PHD$ HD$HD$H= H51諑H=H$H51莑E1H$LRH$aH=H51AHHD$1E1E1HD$H=rH5_mL|$1E1E1A@E1E1AH5CLl)|$pueHt$ Lr+H=11E1H5AE1蛐H=1E1E1H5{D$'H511^L]Ht$ LqtL}]D$E1E1L|IHD$E1H5:L(!H5\L>BuH5{L+BqH$H=@1H5衏JH-^\HLAuuH51{LAubH-LHAuLH$H5}H==kLu|HD$ E111HD$E1E1H$H=R1H5u3{K6qH=H51H=H5詎H$M1E1AE1HD$$D$A!t)Ht!$|HL dt E1E1$D$pt-$ D$pH[HH5WLL$O$LzDt$pIH=H5S11蹍LDHD$ E111HD$E1E1HD$=H='H5q1j7H=H5RLCH$Hy8HH5_HcH9HFHH9zH$H=QE11H5ME11H$HD$ HD$HD$|11ҾHb/H1114HHHD$ |H|$ Ia=H)YMH=L1E1H5*11E1NH$HD$ HD$HD$H=oLH51E1 H$HD$ HXxLVH$HALBH=H5uygHH4$H= _IHD$ E11E1HD$HD$%L4H=H5y1O7H- XLH=taH$HBpH=\H5ՁgH H= L.IpH5~vL$=uBLwH|$H$H|$5XL$IHD$ H{H|$HD$pAH|$D tH=H51AEH5VH=Wb(HHHD$@H4HHoLH7$H$tH="H5K1ĉ$AHH$H$gHt$pHkRH$HAHH6>.$H|$xtH=H511EL$E11HHt$AL|H5LFKH$HtH=rHHL>/H=MHtHHywL~>$tE11ҹH5lu;LD$0MLHH$$Tt*H$MHD$H=H510H$MAE1E1HD$VLGUIIL9UxDŽ$ Hj1H2LLHMEH=H5袇mH$H=H5肇ML$E11HLAH{LL\6LHAAmE#H=qH5J1 H=WH5L.TH|$ IHD$ IE1HD$pH5H=*IHH-4L%d5HuHL~HHVH5HVgAL%dH-5HtLH[~H$HR5VH$H=葂H$HL%1dH-=5HLH}H$ HUH$ H=F1H$Hty1LZ(t0HD$ H{HLftHLoH=11E1H5YAFH$HD$LE1IrH$ H=lH5sjHDŽ$TH$H=9H5|s݄rjHDŽ$jE1UH$1E1AHD$L`qIHt+HLMx$D$pLQHOH=H5]s1HD$E1AtwGH5DsH=e1LL.D$ptK${$8H=H5E1迃Dt$pnPzZH5miH5aH=HqsHHoGH=H5\1]H=H5|1E1A:L|$E1tH$H=nH5OdLE+u H1HJRAAP$H?DY^[iO=H$(H$1DŽ$0L$D$4H$H$L$$0D$0L0DA9L/\L`HL,IHvgMtH5QpLbtH5CpLpbtIqK|,H5QbfK|,H528bMLHP:w@H,HHHHL3P$D$L$1,L=[ADLHHHpkHL/9|HLj!xLEDŽ$A<$+uDŽ$IL6uADžXHUL$LdH LL-`/LHL"xIHPHULdLH 1RL5S/LHLwIHOHULvdLH ;n0H=H$8.H$8LHH$)" eHDŽ$HULdLH mH=H$8E.H$8LHH$z)dHDŽ$HzmH}LLL$`PHkmPD$Mዌ$(MA[]vMAP$ ALADP$H$8TAYAZUL$H$84N^*NclcL-s  LHLGhyLjH|$H$H|$YKL$IH=H5w}+H=ڽH5cy1|}H=H5w1b}H=H5w1M}H=H5w18}H=H5x1#}H=lH5-x1}H=WH5Hx1|H=BH5>k1|H$(L$H$D$4z/ $H$Hn+~ =D$xD$H\$H$ H$D$xDt$xH&+DA9HVLhH$LpAƅtL$LLdH MLq.H-r-+LHHsHH.KLLdLH Q- H=!H$*H$LHsH$HkKL6LdLH izH=H$q*H$LHH$%`HDŽ$LLdLH iO L-P *H$LHLE%h`HDŽ$H$L$`HMHxH?iPHIiPD$$H$H^_v|$LDLAiH=gH5iH\$zIH=;H5du1yH=&H5u1yF[H\$KH\$D$j_:`_H-IIHHHA1ff.ffAU1ATUHFSHdH%(HD$1ILM"H5xHHTH<$tlLHc1IIHtoH5ЂHT1LH#H5HTLZHT$dH+%(uMH[]A\A]@H5sxHyTfH5mxHaTH4$HR1HDATUSwNH HHcH>AH=[H5ex1wH}DAeH=2H5Gx1wH=[]A\fDH5xHIFKtLH5w3KA1EsH?1VUtE,@H=H51KwH=H5Ł16wH=H51!wH=jH5 1 wH=UH5w1vH=@H5 1vH=+1H5"vH}4@H=H5&1vH=H5 1v[]A\H=ɶH5v1kv[]A\@H=H5v1KvH}<H}H}`n)[]A\fH=i1H5\v vH}R-H}G%=t H=)H5b1ufDH= H5r1uH=H51uH=ߵH51uH=ʵH5ˁ1luAWAVAUATIUHHSHXdH%(HD$H1$LD$HD$ )LH-L6H5juH1tL%%IHCLI3LH5 vHH1L5utLi5H5uHH1tHD$@H$LH6LI LI.UHy@IMt LdHH5uH1CtHN@Mt LodHH5uH1tL&11ҾIHH~H=FH5u1sLP11ҾLHH~H=H51s=Ll$L1H5pH-p=ޱtL-ͱL5:L1HHLHKL;IHtyH:HD$HLl2=L-bhLHD$?LD$HT$HH5o|1oE1Һ H5[L'H5pH1`oLxaHH]mH5pH1e GfHcH>  ~6HcDH>D@@dXH$[CfD/)H$$#]GH H5lfDGED$DH|$pLl$pH5(LtH5LuMHH5WZf.H=ɝ11E1H[H50AE1V]H$HD$(HD$XHD$xHD$ HDŽ$HD$@HDŽ$HD$HD$8HD$PHD$hHD$HD$`HD$pHD$6DŽ$0\DŽ$LHcmHnHH(H>1HH8u&H|$XHKH=H5k1>\H/H5H=y1"\KHH5_jH=VH5j1[H$HD$(HD$ HD$@'H H$lHH$XHHD$(GH|$` H5ěH|$`J"DHH$DŽ$DŽ$DŽ$|DŽ$xHMH$pH9H$XDŽ$}DŽ$tmDŽ$]DŽ$MDŽ$=DŽ$-DŽ$G9@9DŽ$`H=}H$kfDDŽ$LH=A 1%;=Y==Ƅ$,oH= 1:8QHڙH>ܤDŽ$$DŽ$HDŽ$HH$8DŽ$DŽ$DŽ$dH5H$H!H$xH HD$ sH$H=R_DH=ј 19H$(DŽ$DŽ$#fDŽ$H$DŽ$DŽ$DŽ$f~D$@f~$foJyDŽ$H$DŽ$DŽ$DŽ$f~D$@f~$bfoxDŽ$H$DŽ$DŽ$DŽ$f~D$@f~$ 8DŽ$H$DŽ$DŽ$foRxDŽ$DŽ$DŽ$DŽ$f~D$@f~$fowDŽ$DŽ$DŽ$DŽ$f~D$@f~$JfowDŽ$DŽ$DŽ$DŽ$f~D$@f~$foJwDŽ$DŽ$DŽ$DŽ$f~D$@f~$HCH$fovDŽ$DŽ$DŽ$DŽ$f~D$@f~$^fot$@fovDŽ$(f8=f~t$@f~$,fol$@fovDŽ$`f8=f~l$@f~$H= 1g6H=H5Ad$,1Ufod$@fo;vf8=f~d$@f~$fo\$@fovHf8=H$Pf~\$@f~$lfoT$@fouHf8=H$f~T$@f~$6HH$"HH̟D*H$E*#H$HHBDi8DhHEuDHQH:2DŽ$DŽ$۟DŽ$vDŽ$fHD$(L-PH=jVI@I}IHLg4uAED$($( LLL$D$L$E11D$D$hA ID9E9t C<(,AUuH 1L$hI< 4IIcAfDD`AdAEL$hHH$HDŽ$8H=bH$H=H5 H$HHzH=H5>U'RH$HD$(HD$ HD$@1HD$HD$E1E1AHD$PfDDŽ$pDŽ$p`DŽ$dPADŽ$1DŽ$!H=1ҾNH$HHH=H5/`:QDDŽ$H=aE1H$HD$(HD$ HD$@@H"H+H$HH$PeHHD$THݐHD$CH=̐Gv/f.H= 11D-DŽ$`%/EH=H51%PL%YH${LdHDŽ$M L~LALDŽ$H$qL-H|$x{LHD$xMF~LLVLHD$x,$ E1DŽ$ $ E1䉼$HH$HoH$hH=[ 1?0$H=< 1 0$8H= 10$<uH= 1/$@VL-ߎ{LE1H$HDŽ$M"~LL2KH$L-{LE1H$HDŽ$M~LLJH$L%=H|$X{LKM L~LE1JHD$XuHH$XaDŽ$QHڍH$8=HƍH$ )HH$DŽ$ HH$0HzH$HfH$DŽ$HBH$H.H$HH$(}HH$@iDŽ$YHH$IDŽ$9{L1~LH:IHD$Xp$1D$$ $G D$EtH<$ H$ $uH$ H|$XHtsH$H$1L$H$ GL9$tLLH9$tLHHwH5[@H$Xd L$H$M H H<$& D$E LLGH$HcLHD$@H$LGH$LHGHD$HHH$XH$H$1EAL9$tLLH9$tLHEH|$xHt4H$H$1EH.H=H58[S$u$$H$ŕHHH=HIHHD$ Ht1HHD$ HH|$(t)H|$(1HD$(HdKH$p3KH$L$HL$ L <[1ҋ$H$~IHH|$t0HL$ $LLH|$XHWHD$H$xt+HL$ H$x1H$LLL8LH|$tN$H|$H 1HHKCHD$HKH|$H6KH$JH=JL$H$P11L?7JH$H5 H=!IH$,tLL4LAQ$LPt$$XH$@L$HL$H$0H$8oH=H H5YRJH$t4AHH@JH$Hy(JHL6%H$HHt HL>JH$HBH=IG=L^GH5WLH$GH$H5HHF111HRHHؐ#H=ːKH5>LH$XHtHL"IH$HtH5"L:H=tHِH5bL*H$HtCH$0HH$0HL9LH 1H9$hDl`VE11j1LL ȌDD$h_AXD$uH=DH5 XCD뛐1@CDfD=UƄ$,H5GD$hD$D$H5H=G1L-FH-aHLH1HHuHuH$I1E1HD$(AHD$ HD$@HD$HD$HD$DŽ$AHD$XE1Ƅ$,D$hD$D$HڎH=+H5/F1B>HD$pHHH=H5Q1BQƄ$,2=HD$`HH[H=H5R1NB H:H=H5R1-BH=qH5BR1BHD$@LHD$@1HD$HՍH5H=1AHD$(E1E1AHD$ H$HD$HD$H|H=́H5R1oA,H[H5 LHHH=a}H5A L5$D$ H<$ H$uH$HD-1 H|$`HH5XQH|$`h1H$$H$0H$9$[H|$`AHRE1H$0HH$H$SIHHH3Hu ʇHD5LL<$)H=L$)$CXC$H5\H1H={H5OAv;H$H$uHDH=HHDL<$H=q{HJHH5P1M;$H$H5vPH׆=$t H*D$D#$4$ȃ#$A@H$uB$tH=܅H5A1i9$]H$HAH=yH5kO149H$AQ1LHH$H$ PD$D$$AZA[6BH$H $ADŽ$,E11H$L$ D$H3A$@H;9$@$>AL$Mu'9LIH;7LH9uH$,t$HHAD1ɉډaAă6LDH7$6H $6$6H=DDH?l6$D$L$ 6HH9H$HH+HHt,H=wH1H5$< 7H5;HlwH$HH6H$9$1H=IH5;6$ $$B2$11$$M4IM3D H$H3L$$1L,53H$1Ҿ LH$$HDŽ$2H$11H%4yL"H93L&1ɾxLH$H3$0$Y0=)0$t>0H5LH$HHuH 1ҾLz$dQ($pdLLL`LL)-9 $`H$Xt;5ɀE1L5uLD$8H$HT$(H$ZYf%$( @HTHcH>HiH=tH5cJ1\4H$H<$L$L<$MLg111IMMHI9;H>;A3AAAAAd;_[;DRA G;H:H$H|$`HH5ZIH=s1A3H$ HlH5}GH=s1AY3H=s-H$H26H$H $1Ҿ7HbHTH=bsH5G13H=MsAH$wH$PH5~7dL*$`1LAH$?HRH*1Ҿ@HH }Q H"IHGLHH-81bL$Ll$8@LLU~ A}"C11Ҿ LL$Ld LuH=1rH5I11H57L11Ht$8@L$EHc$H\$8HyH\$PHt$8HHEQH5|HH$t>LHtLyH!H=r|Ht $L$0AHDŽ$@@HDŽ$H$HD$hHDŽ$PH$8$DŽ$\DŽ$xDŽ$ DŽ$,DŽ$hDŽ$<HDŽ$$X1L$IH$1 H$ 󫋄$ $4HDŽ$@L$P $8tDŽ$P$ $P$D$,d$$ L'L'HcoIHJ $u$t=$xLQ'LG'HcIHJ `L$@$`1H$H$aH$@L1S$yL&HcLHH$0&H$0H~7Ht$PL@LƉ% iH mNHcH> Hc%IHJ `nHcIHJ 2$!냼$u,Lue$PLt9L%L$0%Hcs$0IHJ  H$@L$$fHT$8H=Om1LH5Y3L$L$L$H$D$,$8t$HH=xHFHH$ $HDŽ$HDŽ$ HH$H$HcȃH$H$$Ht$PH$@;~RH$1 H$ L$1H$$H$H 1H#CHT$8H=k1LH5}1L$L$L$H$D$l+L.XH$H56HHL$Ht$hL@H%H$H$LHt$h1LkH=#kH521L$L$H$H$LD$L$*H$5H=jY X독7H TH=j1LH5s1L$L$L$H$D$*IH=XjH5-1LL$L$H$D$)dLI HLJDA}"pHt$8@LH5/L1})Ht$P@L$H=iH5.1LL$L$H$D$$)$0L$H$PH$8L$HHMD$XAKA$\$0L$yL)$HH$HDŽ$PMHDŽ$E1HDŽ$$tH=hH5/LL$>$HH=sLβ$(t$Ht$8H=ah$duD$8DŽ$(DŽ$8$PDŽ$HAH='sH5hB1$d'LL1LDŽ$8DŽ$HcBD;H=gH1H5.B$0L$:'HDŽ$PHDŽ$HHDŽ$AE1>B?HJ,?I{I),H9{{}H HHYE:HIHtIHH5H-L$0AŅJL=H5NZHAH$0LDH$8HH$PH$HH)HHH)H$PH$HH9u HYH$L$H$L$H$H$H=eH5%1E1%H=eLH5@l%3H5,HAML%%H5,HAH5HA|L^5AcH$PH{HH$HAjH=dHH5?1$cLHcLH`H]SHckH`>HHkLcHc;LHKHH$LYH$LL$L$H$H$E1tiL$t=H$LL$L$H$H$L$tAE1HDŽ$H$H:$0L$} EHDŽ$PHDŽ$H($0L$HtH)Iǃ$\L)$HH$PH$&H$LH$PH50*HA<HcH>H=4i1E1H5d%L;|HcHgH$HH|$h@`A$E!EdEH$HMc$L;$@L$HE1HDŽ$P!HcH`HH=YHc$hH\$PHc$<Hމ5~|)$<$<$hO$ $ O$,$,E1H$LL$L$H$H$H$H=gH5GLL$L$E1H$1H$uDŽ$H|$h 1A1HA9HL$h< uM1AMu,$t jH$H=[LH5&#L$L$H$1H$D$DAD$H|$hHHD4HcD7A u݃AHc H$H=(fH5"LL$L$E1H$1H$1AE1H=eH50"1ZH5(NIH=eH5!112DŽ$ DŽ$,DHcH$I)ׅ~rAMDDEDLHcLH`H$0HH$0BH=YH5>!1(LL$L$H$D$H$LL$L$H$H$D$H=|YH5 1QHj IHLHH\$8@LHH5&L111Ҿ LlHL@H5HH\$8hHP11Ҿ L.LLH=XH5P01YH5L1HHt$8@LV$Hc$H|$8H5uڸHHT$8H=EXLH5QL$L$L$H$D$H5=8Lu11Ҿ LDH\$P@LH@;S$L$LL$AL$H$y1H-LL$AILHl$8I}.t8@HL2LH$HDEჼ$L11Ҿ HIDIL$eLLUD*Ht$P@L…RH\$PC DK9HD$Px G H9-H\$PȀ< uI9HL$PP H<{HL$PHcD#L$H5611Ҿ Lvx\HHHLHH$H5LH111Ҿ HL%NL $`$RH$1 DŽ$L@ L$1 Hc $HtHDŽ$HDŽ$H1H 1iHu11Ҿ HSHt$8@H$H|$81H$LS$H|$8H5$$HHT$8H=cTH51H=IT1LH5-L$L$L$H$D$11Ҿ LZH$11I؋$`wH=SH5,1e11Ҿ HHH$H=|S1LH5,L$L$L$H$D$(H=7SH51H="S譹cH=S1LH5,L$L$L$H$D$H=R1LH5L$L$L$H$D$CxH=R1LH5;,L$L$L$H$D$3H=BR1LH5+L$L$L$H$D$H=Q1LH59+L$L$L$H$D$tH=Q1LH5yL$L$L$H$D$/dH=sQ1LH5L$L$L$H$D$H$HHuH$$(HLHNXH5(HE1Ht$8@L,Ld$8HH)H-C)A/HL1Hu/@LLlHAHLHtH5.)L1Ht$P@L*H|$PHH5軰HHD$8H\$8@LHH50HSuiH5m0L[H-X0LHD11ɾ L@HLsuHHL$LL$L$H$D$@HYHHLHH\$8@HH$~.HDPtSDPtSDPt{ u 11H2HH"H54L1aHt$P@LoHIHLHǻAHt$8L@H-8LH51 L11Ҿ 薰E1L$ML$ EIHl$8}.t3@HLLH$kHDEー$L$ 11Ҿ D$ ML$LLLD$ EuH=MH5#%1, H5H=iM1LH5L$L$L$H$D$ LH8藯1Ҿ9LH &XHDŽ${H1IHMHH5LeH$LHbLHH]LH5LHHH(IH-8$HID$LHp11Ҿ L臮LHt$8@LLcEUHD$8L$H$H$L$HLL$LH$J芫 =$/L$HH+$L$L9 H$HLLL$1$H$H$HL$H)H9kHIHLH$I)LH$L$Ū $@$L$IHLLH$L+$w$X$ JH$H9H$H)H9%1$<H $H9$$H=J1LH5S$L$L$L$H$D$ ,HIHXLHH\$8{-u@HLH$uH! H$$( H$H5L1 L1H-11Ҿ 蠫L$MIH\$8{-u7@HLLH߉$聩HE郼$M11Ҿ LL$0LL uH=HH5N 1WH5L$LL$L$H$D$H=iHH5z"1 @H5w L1H=9H1LH5L$L$L$H$D$H=G1LH5L$L$L$H$D$nIH=G1LH5TL$L$L$H$D$)H=mG1LH5 L$L$L$H$D$IH$LL$LL$L$D$H$\H=FH5V 1IL$LH$LL$D$TH=FH5 1?MH$L$H$LD$LL$H$H$H~bH=3FH5x 1bMH$L$H$LD$LL$JH$H=EH5 1sH5LLH5x H5PL輰BHHHL6I~H $Ld訧1ɺL蔧A$1IMH=E1H5L$H$D$LL$H=Da$u$$t5$1L赴H=OH5 1$f$1茽H4$LI}H=.DH5L$LL$L$H$D$H=CL$LH$L$[D$L$1L!HDŽ$LHDŽ$L1Ҿ#HDŽ$LHDŽ$¥ L$L$L赛H=>CH56L$1H$D$H$iH$茡$蠧-H=B1H5L$L$H$LD$L$[H$$BIL11ҾyHL$L$L$H$D$4H==BH5H1H$'Lm H=BH5L$LL$L$H$D$zH$H=A1H5KL$L$H$LL$0LD$UDAHLtHRD$L$ ~A$"A0D1@HHtcH$BLL$L$H$D$H=KH51ZDL$H$ H$L$-H$$,H<$L=P| H$ H$RH t;H$9Ht"H$ HHHEL $H=?M1H$H5wH=?FDŽ$H$HtH$HH$иHA腩$D1ɉbAăHIHRH$H$H5ZH= ?1H=>舥}HJH=>H5Z1HD$(HD$ cH=IH51[鈸H$H=IϸH=}>H51H$H=[>H51H$H=PI}H=)>H5AAE1H$1=It =It`HIH=HKH==H5k1E1AhH$՛H$AE1鿛PH$HHtH$uBH$HmH=J=H5E1AH$RH=!=H5AE1H==萣H(H$H$E1AHD$H$AE1HD$ךH$H=<H5_1ɺ!LH$L良H=b<H5EH5jHJH5 H=,<1H=!<H5AH=<蓢H$HH$H5뭋$<1ɾ}LHx$<H[GH5 AH=;JH$鷙$@1ɾ4LH$@HGH5A AH=L;H$d$81ɾ~L4H$8HFH5n AH=:H$HFH=:H5h AuH$Hc$1ɾ|L豿HHc$1ɾ{L茿HȲLA۲L/黲eH @H59H=QH$H5z $L۱H5oLzH=9iH$D$LH=9H5ANH$黗H5HH=n9H5W H$D$鏽H\1ɺ!HL9-t=.AT3.A|3--1ɿHuHH1H?ƒ!Ѕ0H=84HEDL1H=8H5 5+Hy8L5H ?H$1Ҿ6LH$V?HCH5 HCH50/H=8蟞HCL1H=7H5 閼H9$pH5eH=+DD$L$ LL$L$H$Hz9$V1L$ATD$D$$Ht$H$ լ_AXH=#7LL$L$H$蓝SH=6LL$L$H$gHH$IqIXAWAVIAUAATIUHH=AdH%(HD$1H$mH=M AL=LLH==AHIHH$IcH9|ULLzH5dLPA($HT$dH+%(H]A\A]A^A_H=5HH5WD1EH5L葭1DL`H=@H5L1L=LLt`H=@LL1H5rH(A1A,H=a@H5!{J@H=3@H51mH$H= @H5$1GfH=4H51+5?uYH=j411Ҿ 輖H=?11Ҿ 觖1kHQ?H=24H511HDH=4H51ff.AWAVAUIATIUHSHHL5kdH%(HD$1L裞L9uFHLLAąu1H=>Ht]xAąt&H>AHHAHD$dH+%(=HD[]A\A]A^A_DH=A>HIHH5HƦIHžIHtH$LH讍u*LH5A֪L^fLLutH詡L蟍tH5LA聪L3fHq=H=R2H51H=12H51H5L%DAW1AVAUATUHSHH|$菘HH}IH}H51I\$cE<$EtNL-[fELAǀuAH5^HDP@IDH}D1HD{EuH}H51HuHtPLAąuiH=<tWH}H51H5f<H|$ԶfH}u)fAHD[]A\A]A^A_E1DefAWAVAUATIUSHHxVH|$EHt$8HNrKHCHHD$@HCLHD$PHC HD$HC8D$4HC(HD$HC0HD$ ;1HL$XsHHD$(H4A11Z1蓏1,f.AH=,NfHt$H1!HHHD$HT$蒊HT$HIHHVHT$HHHL$`1ҾBL11,DH|$`LLH H|$`藚9|ˋHLE1PjD$LPLL$@LD$8HL$pHT$hHt$`H HHH=+H5CE1AUH=+H5JE1:H=+H}H=i+H51AH=I+H5 Ah1E1A2f1A#H<$1%H=*H5 H1HD$1E1A1IAIAf1E1E1AH=*H5w1E1AHD$xH=Z*H5sAPH=<*H5E1E1A/:LfAWAVIAUATMUDSHH<5Ht$AL$I$AIH|$LA-uD%5EtE1HD[]A\A]A^A_H=4H51+HD$AH=4H0H=4H5sw˸fH=4H51E1tT@EAwH=z4N,HAU聸AEE|D9v"EtH=N4H5UH=14H5v8AU11ATIUHH褭LH5 H1011HLH5 H1 11HZLH5 H111H5LH5 H111HLH5 H111HLH5 H1w1H1ҾƬLH5 H1R1H1Ҿ衬LH5H1-1H1Ҿ|LH5H11H1ҾWLH5H11H1Ҿ2LH5H1H11Ҿ+ H11ҾI]LLHA\H5 1A]}ff.fAVIH=3AUATA UHSH艑AfD3HV~/H52HA9IFHLtAu[1]A\A]A^[]A\A]A^fATSHHD%+2HXEtFE1+D2HHA41t=1%D9HD[A\ÐAWMAVEAUIATIUSHHXIƒt(t# 0u,HcD$PH[]A\A]A^A_DMtA 0tH50HLT$qt$XD$XLHMEPL2XH߉D$`XZHt$?ff.fAW|H5%IAVAUATUS@HIHHHrHIH H@uHHH=&1IIH=0MtL2LL1ĸHHHL LŔLLmPLH走5O/y0t9$H5NL腪H 60LHHD /1脌HF-HH11ҾeH譅~H=B#H5T1L5LID$HD$@LHHfH=O.L1H@tH4/H="H5?EH="LE1~/H5LzL®HjH[]A\A]A^A_fDHT8H謄1Ҿ9LH -HcIT H t tt.(H5LMH\$ADH1H=,H1.H=,RDLA11L DLH°H11Ҿ Hz~LH=!茇yL訽H5SHIL5:,L芽HLf.HcDxICH5ٞLaH=+H5T1'H=+KKH=_ H5I1 +E1H=4 迆H @H51H=7~=@AUATUSHH $HH $H(dH%(H$ 1H=f,H貾H=+H裝H+IHt_H=*H51.H=*L_L-*L谬H5HL辝LH5LH褝H +H5\+Ld$ HL/HtH=K*LH51H躎H"H=#*HIH=*HH=*1HH=)H衞MHH=)LDH51L HT$Ht$H蹭H|$t?H=)H51Ht$H=)T$藭H=x)H5,l1HZHtHH=S)H5|1H=H=.)HH@H=*(H=(H518H)H=(1H5H=(1H5Lc-|H5LIHLL-)L jLE1jHcbILH\ZY"H=S(H5O1/~51L-xf.AH=(1LHV9H='H5j19 H5L腔H蝎11ҾIH~H~H=PH51H11ҾLH~H~H=H51H=p'11Ҿ Z~H$ dH+%()H( []A\A]DH=1'H5"1k-fDH='H5 1KfDH=&H5 1+fDHIHXH=&H5s 11ɺLH=&~(@HaH=y&H51fDH=Y&H51H ,LH5m1H=2yժDAWAVAUATIUSH|$@dH%(H$1H5NAŁ|A 6IH&H=&HH&MtLLH輿H,vL|$1E9IM2&11H=&yH{H9%yH1ɾxHH%KHt H%t$H6HHQLILLHH蹉H豵H5*HR%t9?H5(CH萟H A%HHHD $1菁)%D5$AH\$(L-9 EHٺ@LHAƅq1HoH5H=+1AH=~H=s#H5 1HHH=N#H51 @LH:H$dH+%(-HD[]A\A]A^A_軡I 9f|$Ҡ"H=EH5R1fHHI8y1Ҿ9HH s"蛫IHH5HT$(HAYE~ H H="H5xLH4tHH=ItL$Y\$9L$L5HHD$H0pAąu D"EQHяAD"EtH赏DH萫AŅHD$$蕲Ht$$H=6"5$"L%d\HE1sÅi !D$(` !HHÅ#!!H=+1H5>HE}H5 H={H踱1H|$$EADH\$@1HHH=躡H=A諡HccDLcl$ILHJ D@CHHL$H L@!E1|$11HHH=0HcH=H\@LHH!¾HL$H#L@D$HD ^ E@LtË  Z uDUAD'LCufDHH.E8Du1Ҿ9HH {fLD$01ҾIHLLD$t{HLD$ H=H5~1AH=11Ҿ tH=9xH=H51H=t11Ҿ ^tE~ IcHD$D)DD$EH=1H51AeH=11Ҿ tH=H513H=11Ҿ sHcL% (H=H51H=LH@/jHƉhtHh IcL>Ll$01L!HD$0LHD$8sL1Ҿ#HD$0LHD$8rfDH5ɎHQ@H=qv+ƒ߀KuAW  HcLqtH=11Ҿ |oHg1ҾHA@H舆>,}}H=H5q1JbLAi薙H @H5 1H=*!hAW|H5 AVAUATUSHH|$@dH%(H$D$IHTBHH袛HIbHڸHIMMD=SE@uHHH=+NIHzDEHtH5sHL |$1ŜHH D Et+HD$ùH Ht$HH 赔HHLגLxLLmjLHDEAt9$H51LMH LHHD 1Lp=~H\$(Hٺ@LL膼Aƅ91L^H= H51E1H=mH5RL~L,HoLoH$dH+%(( H[]A\A]A^A_fD|$DEH=[H5h1H88Hh1Ҿ9LH oLx HD$(H/ Af.HL5f11ɾLhH@LIDy1$ H5Lq&HLquAT$Mt$SL3fD./\ HHJR :itW \/ H뻐H#uLW~H=L1>HtH貵DH5yLp| H5LhpH5RLLpLlH=]H5;1L荥ƅ^ Lt$01LcL$LHLLL$jT$E1Lэz1H1H \0*LL$)H=H5ef.fH=H51H=jH5FQH˞LH`1LHLHLdH5 HH HD1LrIHLL5HMHH5HH1FL莡HHyLH1&L_HHLH1LIHQH5LH1LH&LH H5H輝f.Hct11Ҿ H>d~LE1χf.LxH54HL5 LZHLlf.H=yhH5L)L H#\0@LHH5H1МH5!HH5H貜H5OH補 DH L4Au*O<&HLH0AFIt'<< <>uH5HI4AuٺH5XHH9& xH5tNHLHnH5_H1ݿLHHnD$1H$IHYLAHD$~HL$H5sHH1}DD;t$tUDHAҙHHD$H|$HD$6~HL$H5#HH1-AuD;t$ H5MH @LL荞HH&H5H1E1ݾD$u2fHHA|CH<:uغH5HD)QD$D$HH5Li=UUUUH&WHGE1fH5H1@H5H@H5|LHLHt$?pH|$蕊Hq@F@ HQ@:@.t@/@\ qHQ@@ Z@:P@/@\@@AHQ<: < 5E1H=qcAD$]xN1HHH)t$E1HLHT$AHT$yLH5H1DHaH|$HLE1QH=H51H=L`ZAL!eHcH5SI<HT$谚HT$I|H52H|$荚tqH|$H5xt\H5}HuH=LH51XH @H501H=WBX蘉H5IHnuULH5H=BH5;1E=xH=LH51躸yHH5HL$衔HL$HLH51舸H`_ff.AW|(AVL5AUATILUSHdH%(HD$1bHHHuLڅ1LpTED}1LL-谅lLLH͑Lc}|LHELHHpH}H]HLH$S9EuVH'H=H5yH-HE 1oHD$dH+%(H1[]A\A]A^A_f.H=H51+H}LzzoH}L{io|LHYoH=9H51۶hH5H'oSfH= H5Z1諶H}LpnH}LqnrLHn߆H \(H5L1H=s^U#H ZLH5(1H=O:UlDAUATUSHHdH%(HD$1HtpILcfDH[ HtW9kuH;LLtauHCH=H5H$1裵HcSH1LH YDH=H51k1HT$dH+%(u H[]A\A]蹅fAWHAVAUATUSHdH%(HD$1Ht$тH-HDt$IE1LHE IHtdH9]uL}LLLz`uHE Mt\ID$ L%wLLmH}LlLHlHD$dH+%(uH[]A\A]A^A_HÄU1H,yHH5|HH5mHH5]^ff.fAWAVAUIATL%USHhdH%(H$X17LH=HD$@HDŽ$(HDŽ$ HDŽ$HDŽ$HDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$HDŽ$HDŽ$HDŽ$pHDŽ$xDŽ$HDŽ$PHDŽ$XHDŽ$@HDŽ$HDŽ$-L-HZHH64bJ<. H$6IMHHD$8HH$ LE1SLHFD$pE11HD$hHHH$HDŽ$DDŽ$DŽ$DŽ$DŽ$HDŽ$LDŽ$PHDŽ$DŽ$THDŽ$XHDŽ$`DŽ$DŽ$DŽ$DŽ$D$`HDŽ$hHDŽ$pHDŽ$HDŽ$HD$H$DŽ$D$XD$HHDŽ$HDŽ$HDŽ$HDŽ$8HDŽ$0HDŽ$DŽ$HDŽ$(HDŽ$ DŽ$DŽ$@DŽ$DŽ$D$TD$xDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$DŽ$HDŽ$DŽ$DŽ$DŽ$DŽ$DŽ$HD$HDŽ$HDŽ$HDŽ$HD$ HD$HDŽ$HDŽ$HDŽ$xHDŽ$HDŽ$HDŽ$HD$(HD$0 XDžqYWZDGEH5!H=1[HD$1AHD$E11HD$HD$ KHD$1E11HD$AHD$HD$(HD$ HD$0H=GH=ze11LmH|$^H5#kH|$Ly^H|$ cHcH$ ^H$^H$ LeH$ LeH$ LeH$ LyeH|$8ZHHt=H;LPeH{L?eHH[ L溽+eHuH= LHDeH=p LdH=T LdH= sFHK]H|$bH$P LdH$@ LdH$(J`H|$(tLH|$0>H=xH=HxHH$XdH+%(e(HhD[]A\A]A^A_@AG'At(G=HcH>D0@#mx?`0DHt$8N$%D#H|$(H5,H|$(itH5H|$(uiHT$hH=H5R1胪#H=H51iHT$hH=H51Of.1Xt@=|$HH$ uD=E$H55$$|$T$DNEtD$H52E $DYWEv$=@5DŽ$Ht$H|$ H$H$4DH=]H5:HD$H$(HHD$HD$H$HHD$H$O]\$IHD$1HD$HD$ H$t)H$H$X[rH$PHHZH$0HDŽ$@t)H$0H$HrH$@HHH|$tN$H|$H ts1[HH$HD$H#H|$Hf#MH$pLD$0L |H$$HID1H^HH$H$L$L'VIH $H$hHt 11H$L!cH=.$H$1$H=HT$@HEH5HD$H$H$RHHHv#1ɺNl|$x#HHt$(LbhH$(HtH=pH萓1#$u"$LtH=B1ɺ!k|$H|$Xn$H=HtFBQH#H=H5zES"HH=H51H$(HtH=H5 $@#$H=#$#=T[#$P7#$H#$Z'=3'$H= &$v&$2'$~HcCH=H$HtHWH=A'P$$PL$D$$H$$(H$:ZY;!$H=rtHt$8WH=_'L|$1L`H=AP$PAW$H$L$L$H$H$`H H5 H&HT$@H5H=OHgHx H=g1H5衣|$x&H=GHtFNH<&H=H5P HH=H5H1DH$(HtH=H5)D}$@%$H=2&$&=#AR$$H=yPL$D$$H$$(H$8A[A_Z$H=1tHt$8UH=#%Ht$1^HHt$(L]2H$PtH=<H$PH5(pHH$@tH=H$@H5?j$1H$H"E1L%t11H |J[IH=oM!H51蠡H=Q11Ҿ ;DLӚV"H=|L Q!H=H$$H$11ALsH IbZHHD$@X$H=H51H=11Ҿ CL2WL|$@H=~LnP!E1L WD$H$ HT$ Ht$H=SyH$`HtH=H!+H= HtD$HT$1H6S*Mt*D$H=2HLH$S$&!H=at = H=H5|NH$8t1|$H!H$8H=nH5QH$HiH5vOWIH@111H4WLH lH=H=HH5dO$H=.H L$R@H=LH=H5xSH=H5U萔H=H5H=H5:^H=KH$H< ?H=(L胋LHH=5LL$pH$xلL1Ҿ6H=cH=$5L`L訄L1Ҿ6H=RcH$H$HTL=H$0lHAH$0HxH@HHH$hWrH' 1L>H$0LeH5"L΅|$`H=JH$X\ADžD$ptH=}a$TtH=S$$D<=pH$HD$pu=HH?HEHD$p$t$t H$H$HH$HDŽ$8HD$xH$Ht$@H$MZHt$@D$HOH5H=訳&H=IH511HD$H$(QfH=H5E-TH~HHH=HD$ H5~HD$1E11HD$AHD$t>D$xtD$xgDŽ$@WH9y{DŽ$DŽ$HHyHH$8LLAL$҈$AiL$$HLDQ PHuoHaH$THML$HH$9MD$H.H'L$HH$9MD$HDŽ$qHH$(H= 1z$H= 1fz$jH=c 1Gz$KH=D 1(z$,D$XD$HD$XD$HD$XD$HD$XD$HD$XD$HWDŽ$HD$@WD$XHD$@D$HDŽ$WD$XHD$@D$HDŽ$UDŽ$E6H=/ 1yH~HHcHH$pDŽ$HH$HH$HH$HH$0rcH\H$OCDŽ$P3DŽ$H#DŽ$DŽ$DŽ$DŽ$DHH6H= 1wvHH$XH= 1lwD$ppH5@H=Y 1=w$T>H5fL$p@ED$pDŽ$LTHH$DŽ$HH$xHH$DŽ$DŽ$H=|H$j+bDsIs:DŽ$*H#H$DŽ$HH$HH$HH$DŽ$HH$HH$H=/j[L=.D$`!sD$` H= 1tD$`YsHHnsHHcsHH;sE11jH=L@HHjHp PQH _D$`xHqD$`Hr]DŽ$MH$LXKH=1 L贏H$HHH$#LKD$THDŽ$H= 1s$HH$HH$H$H=(}L-idH$HSHD$IHBH$p5H.H$h!H$HHD$H$cHHD$ HHD$HH$`q|$TD$T|$TD$T L$T1LH$ED$TIH$LHDŽ$^IH=7H$H$HDŽ$! HT$hH= H51诐Of.H=T,H= 1qDŽ$S1H$8]H=P-|$@g+6H$8]|$@L+H= -H$8~]H=w-hr9D$`H$a|$@t}|$@ O_0Ad$H7G0H$89D$THFH5H=fH=,H=MH5ֺ1臅/H$ T$`t$X1ɿ H$6D$@T$`t$X1ɿ6D$@HD$1E11HD$A HD$1E11HD$AH=H5фH=jH5A蠄H=H5tH=,H5՘hD$D~H= H5{1FH=G1KH=H;1K,H=H5HD$1E1AH=)H5AE1_H= *H1.1H$HD$hHD$1E11AH=-H5^i4SE1AtH5,H=>H=A *JH$(H=hH5)AH=O)t$xH=%BH=yt =t*QHuH=mA7Hr=HAtH=WuQHDHuH=H5%ANlH=H5S147H=0N}H=8}H=1ɺ!KG1ɺ*5Ge11Ҿ,"GRH=H5IHcT$XH=1ɾ|FHqkL?L=aLh1L@H=[FH=LАHt#L¾?gL1Ҿ@H=xFH=H$H=M1AH5H=-H5f1AɀL$MeL@H=HNH=<@Lf@H='HN$H5өH$H5H=1ACH='UH$H5H=H=H51E1H=11Ҿ "H=1ɺv"EYH$H=etH$A11LQH A(8IH=ǿH5 k[H=?&L5LA5gH=H51[H=z&LAg55H=1ɺ!ZDH=H51~H=L=}LH=fHLH=YH51~$1ɾ}CH=|Hg$HT$hH5АAH=F~d$1ɾ4CH=/H $HT$hH5CAH=N}H=H"yH=x$1ɾ~CH=H$HT$hH5FAH=ѽ|}H=H51A\}H=0$nH5MH=H5I1*}H=H5DH=Dt$xH=*<O1ɺ*4B11Ҿ,!BH=]M1ɺvAfDAUIATIUSHHdH%(HD$1EHlH1LdHHH1ɺHHHHHI#LHH:GLB]LH$sDžxHA \qHD$dH+%(HL[]A\A]f.H(HE1LFIHdHHfH=E1!"HGH=yH5{1{Hc=Yu(H=Y!HLE1@-?5H=,H5H1z4K@AWAVAUATUSHH $HH $HH-sE1HjL5dH%(H$ 1AI})LDHHD$hE1'D$8IHD$D$XD$dD$`D$\HD$0HD$HD$(HD$ HD$HD$PHD$HHD$@f #|wHcH>wʼnuf.A1E1L+HUH$ dH+%(F HĨ D[]A\A]A^A_f1'9LH5ǸH=O1xfDD$#D$ADADADADL=ɸL#HH= LH5\fADD$Xf{H=LLW1xZf.D$dCD$83D$`#D$\H HD$PHHD$HHٷHD$@HHD$0H=$HHD$HqHD$ gHYHD$OHAHD$(7HE11E1`&vH|$H|$hYHHFHh1L{H;HuAE11L|H;Htۋt$8yH|$tHt$H>tH|$ tHt$ HcJtH|$tdHt$HESHT$H5HL$0HD$HHHEHHD$0 HcHHD$lPLL$`DD$lHL$PT$pHt$X ZYDd$AZ\$XH51E1 1.^f*X^ tLHcHHI1:HL$8H+D$MT$H56H1 Dd$E1AH=V9[Ht$(H1jIHMtXL 1AH$HʽH"b…SHLmo@ HL LLjDžxq1E1E149HcL$XH=HHL$HD$vZH|$pH|$ ^HD$pHZfLL;jDžxLA$rH5IH=E18H;D$Ht$(HLHM{H$L 1HH`…HL%n@HIź HL L t=;1=@Ǎ|*'HT$0H5"H=K1pH==QILDd$0nH=H5 AE1pMABH|$ M]H\$p(ffLH+H*DH*H5^fA*X^EthLIc1HHI6HL$DMH+D$H5E1H1c@H=<H51Aon16HT$H+D$H5+H1\BAWAVE1AUL-\gATLU1SH̸H8dH%(HD$(1D$$D$ 3D$D$IH$HD$HD$qADžEGA wJcH>fH=9HT$$*ufDH=)L1E1H5AE1nLLLgHD$(dH+%(H8D[]A\A]A^A_fDHH$ADžOD1q\$$H|$1ɾr=IH1Ƀ11H%IML:L;]HH$Ht(H'H H4$L6GL$EÅu E1T$ H|$1ɾwY=IHT$bLH$D$KH{HL0HD$ B=HLbC^H=cH5VAm@@DuD@ED$f.ED$fHHD$HHD$qH=ɬHT$ LDLE1E1E11E1A8H5f*H='*HWI D t$D$ =uWLLE1%H=*H5AkH= H51E1AkH=H5:Q1AkH=ɫH5mAE1dkH=h(LL-6\LL)LH=H51AkH=fLE17EA:HLaH5LF=;ff.fAWAVL5aaAULE1ATU1SHH(dH%(HD$1HD$ZH$D$ IADž'AIA@~AwHcH>AAuL1E1E1H=QL2H<LdH|$*dHD$dH+%(LH(D[]A\A]A^A_@D91E1AH-ɩ@MH5L8(LH5"^@HH$D$ H<$HtwHt$uiH$H5H=DfLH5H=?11E1Ah dIHHZf.H|$HT$ HH%H=HIHH(LHxH=qHbHHI`LH2HLHLI:H=[H5HHH_HD1gH_H=-H5HH1gH0H= H56H1gH D$ H H=ܧ11E1H5Asgf1AYH$HKH$H=mH IHH'LHFH|$L52HKH=+HLH_HH1HH|$JHH=%HH51LAE1fH= D|$ H=H5'1E1Afr6DATAHUHH"+t uAuH .HD]A\DAWAVAUIATUSHdH%(H$1HHDŽ$HDŽ$HDŽ$HDŽ$HDŽ$DŽ$DŽ$DŽ$HD$ DAHu2H$dH+%(lHD[]A\A]A^A_fDLIE1H HRA@E1HH-lHD$PHD$8H{HD$hH$HD$@DŽ$DŽ$D$|D$xHD$`HD$XHDŽ$HDŽ$HDŽ$HD$H$HD$(HDŽ$HDŽ$HD$pHD$0HD$HDŽ$HDŽ$HDŽ$HD$HD$HH$S  '.|(wHcH>D$PfD==~/#wHcTH>@=DA=@#whAHD$=FEH=cHD$HH+HD$1E11HD$E1E1E1H$HD$8L~tR$DHHD$pH$H=&HT$8H=ܢH5F1~bE1HD$HD$1E11H$E1E1HD$8LDD$(LL$ H$LL*H|$*H#H|$ H|$LH<$5H$HH$\H$>H|$@]H|$8Z.H$M.H H|$H5BH|$Hu>DD$(HH$L@H$HyH$$@D$PH8AHD$hH=NtE1HD$qEt Av AvfDEt AS ASfDEt A"* A"~fDEt A A^fDHHD$GDŽ$0D$xD$| HIH$@H1H$@HH$@HHD$H=H$f.H|$0tVH|$(M Ht$(L&UH|$ Ht$0H|$2HD$(H[HD$0 HѠHD$`H1HD$XHH$H|$(t`M/ Ht$(LHL$0HD$(HHEH|$HD$08 Ht$0H|$IxHD$0HHD$(OHH$4@HqH$@HYH$@A@AAA AAEt A5A5fDEt A$)A$ffDAWH=1Ҿ5HD$@3A$@AÀ!@HcHœ1H,H}tHHH8uAHH|$XHtH$H|$`HtH$D@D$XWH|$0TH|$(4 MC Ht$(L H|$ HD$0HL$(H|$HHEHXH|$tH|$1HD$H!HD$(HD$0D $AOAŀtDŽ$u DŽ$AH|$Ht 11H$LL  H<$A" ˆT$`E1A"tAS8 HD$D$`H$$H$1ɾrLT$0*LT$0HHD$8v D$EH5H|$ =LT$0HH$H $=v =C  H|$8H$LT$0]-LT$0HHH\$pHt:H$LT$0&H5C#HLT$0HH$H7$H$1ɾwLT$0)LT$0HHM A$ A# |$XD̀D$0AS Ld$ 1Ld$(Hl$PH,$Dt$pLT$XL3H|$I3L#11LIIH% LD$@HL$1L$L $}HH DD$0H$HLH$EIH L H10L9ADt$pH$Ld$(LT$XLd$ H,$HHl$PASDl$01H |$`"A$ EIHLT$ H$H$V?LT$  H=H5"14XH$H$D0H|$(LT$ IHH5@zLT$ HIE1HH\$ LLd$(LEIMDHA)2HH-HA9|ILLd$(H\$ LLt$(IH.$LT$(LLT$ E1 LT$ E1E1fLbA5t)LYA"tALHMLDH NHT$8H=WH5x1VHD$E1vMLA"t#L A$tALIHLDH LA5t)LA"tA$L HLDH TLyA5t)gLA$tALȌHdLDH ML7A5t6L.A"t#L9A$tALyHLDH L A$t)LAtA"L7HǩLDH *@PIHGf.PIH'f.PHD$HkPHD$HHD$L ;EA"u A<H|$H|$1E1HD$HuwH=H51TE12HT$`H5H=T0HT$XH5fH=0zD$EAŀHD$HD$AE1`H=tH5E10HD$oH|$(MH=;H501S@H$/OIHH}H0Dt$0HIL$$$HL[H}HHI1ɺ1IHuL$$H$11MIE1AHD$HD$8H=qDD$0LL$(LT$ LT$ LL$(DD$0L|$0L <$ H=3H501RHD$/H=H5..H<$L11HD$H H|$0d D$`E1LD$@HL$1L $H|$0LT$8 LT$8HH$!HD$81E11E1AH=dH5-.k>MIHLASAvL]H&LDLAS=AvL1H&LD"LZASAvLH&LDL.AS>AvLهHw&LD#AvLH\&LD@L4A5qASLHLDVHD$H|$0mHD$(H$HD$H<$H$HD$0BfDDD$PDHt$8L׀L H$ELD$ LT$ DEDDl$00ALT$ H$HH1H$Ht HL$hH1LT$ H5O-PLT$ H$Ht HL$hH1LT$ H5+PLT$ H$Ht HL$hH1LT$ H5 OLT$ $=LT$ = L$0HT$8HH$%LT$ E1E1E1$1E1E11A2HT$8H=H5|1@OvJHD$8HHD$L$xD$LT$ L$H$t$|H$\LT$ HIH5dHLT$0HD$ rLL$ LT$0$+H$L1E1E1A_ML$$Dt$0H|$#H|$11L>H$L$ L$H=LT$ 11E1 H$LT$ E1HD$AHD$8HD$1E11H$E1AHD$8H=1LT$ 1H5{E11MLT$ AE1rH$E1>MML$$AHD$1E11H$HD$8"H|$811LT$0H$OLT$0HH|$8H$LT$0H$SLT$0HH=?H5z1LT$ LLT$ 1E1E1AH|$0D$`HD$)H=H5)1E1LHD$H=Ȍ1E11LH$E1E1HD$8A"Ld$ LT$XH,$1Hl$PAH,$Ld$ 1E1Hl$PLT$XArA@j$dDLT$P11@D$0AR5LL$0HL$HH$>HH$IY^LT$PA1M"H$ރ%H$H"H$89|MH$D$`"H$11E1AH5yH=]1KE1LT$ E1ALT$ H$L$0AvHT$8HHLT$ 9A5HHLT$ E1BLT$ E1E1FLT$ H=ՊH5x1wJE1LT$ E1A9H4$HT$EHLT$ H=LT$ H5xH$HLT$ D$0T$0Ht$8LT$ LT$ tH$wDl$0xA1E1E1LT$ H=H5L&L$0HT$8HH$;LT$ LL8LL$ LT$0HT$(HD$01H5H=LT$ E1>ILT$ LL$0ALT$ H5E1LHD$E111HD$E1E1E1H$HT$pH=%1LT$ H5HH=H5O1LT$ H1E1Af|$PAHH5HHH=ff.fHH=ff.fHH=~mff.fHH=Mff.fHH=-ff.fHH= ff.fHH=:ff.fHH=ff.fHH=~ff.fHH=}ff.fG7'ATUSH/H(H]toD%EtUE1:fDޒHs&HH( H~2ĒAt=%D9D[]A\fDA[]DA\f.ATD%sUSHHXH0EtRE17f>H%HHHc$ t0*At= %D9D[]A\@A[]DA\fAVAUATUSHD%dH%(HD$HHhL(ELt$Hrf.LHL0HD$dH+%(WHD[]A\A]A^fD>HHLH$DLtAI111L At=%D9PLHLPH=H5@{WD8fD%Lt$EtE1Lt$H`VfDvHHLH$DL&tAI111LDAJ=!%D9/f.AWAVAUATUSHdH%(HD$HD-֏L`Lp0H(EE11@Zt"1A LHH "l rLLHH"DLBLLLH-CA=%9=َtN1ɺ HK(v!t1ɺH(11ALLeH5 =^L|$ y1LHH"D1KH5pH=EAH=9@HD$dH+%(u?HD[]A\A]A^A_H5xH5xH5upH5xH5xff.AWAVAUATUSHHL7dH%(HD$81IFMnD%I(HD$IF0H$EE11Dt"1A LHH   2LLHH DHL$LLH Ab=ی%9I=tN1ɺ H &ssv!t1ɺH%MH $11AL"H =t111HLAoF8HL$ H߾)D$ _%=ȋL|$ 1LHHpD1]H5nnH=Z?H=.cf.HD$8dH+%(uZHHD[]A\A]A^A_H5vH5vH5,vH5[vH5nxH5ulH5u`1AWAVAUATUSHL?D%I_IoEteMoPMw`E1Bf.IGHA$HLHIGPI<~6At=%D9HD[]A\A]A^A_H=i~H5u1A>H=N~ff.fAWAVAUATUSHL?D%$I_IoEteMoPM@E1?IGHAHLHIGP׉I<~6ЉAt=%D9HD[]A\A]A^A_H=}H5t1A%=H=n}3ff.fAWAVAUATUSHL?D%DI_IoEteMoPM`E1?IGHAHLHIGPI<~6At=ш%D9HD[]A\A]A^A_H=|H5t1AELFEtLE1I.DA LHLH~MAt=؃%D9HD$(dH+%(uOH0D[]A\A]A^fH=wDH5f1A27H={w@DAWAVAUATUSHL?D%TI_IoEteMoXME1?IGHA$HLHIGXIdH%(HD$81H|$4HED$HÅu%HzfHD$8dH+%(uFHH[]fff1H+zH*H*^D$)D$ff.@ATUHdH%(HD$1HH$AąuHD$dH+%(uFHD]A\;E1HHtH4$HE1)AH#H<$ATUHdH%(HD$1HH$AąuHD$dH+%(uSHD]A\E1HHt"H4$E111AHE1AHH<$-'FfDAVIAUEATIHlUHHH=lSHEHtUEtdHAEI0HiNM(R!DLt HNL9t(H}HHHu[1]A\A]A^f[]A\A]A^fATIUSt5BH0HiNH(RH;HNH9uI<$[]I$A\fDAUIATE1UHdH%(HD$1HH$+taRIHtKH4$E111AHQt]Lc~O11ALLkwL#t/H<$v%HD$dH+%(u#HL]A\A]fLE1^f.@ATUHSBHI'Mt"~ؙu.[]A\fH=jH5u1*[1]A\@LhH=jH5ʀH1`*[1]A\fATH7\UHcSHH H=jt~ܭAH5vuD$HtuHD)fIcf*D$HTmH HP* Hv^Y H[]A\HH5!u1)H=isuH[]A\AWAVIAUATUSHHT$dH%(H$1D$,D$(HD$0HcHl$8L|$,E1HiND$D$fDH|$ILLALHwH|$8(H= iH5;t1(H=htD$D$ HD$@H$H<$1E1E1Hl$0HHD$LH8t^Hx1HlH|$0`HD$Ht$(HJ|(Hc|$(L$(IHJ D@A9DLINL9uAKH4$E111A|$]5Dd$1d@xLHD$H=gH5sAH(1v'H=gJD$ |sHNH9HD$HH8tLl$0Hx1L'H|$0HD$Ht$(LH|(H|$0u$Hc|$(L$(IHJ#D@xH|$ANLLHHwIx&FD$,yD$HD$AH(HNH9$Dd$L$T$ H$dH+%(D$H[]A\A]A^A_f.uD$,fD$f.INL9|$tD$ H@H=fH5b|1%H=eD$ qAH=eD1H58|k%H=e?4D8H=eH5p15%H=~e CqD$fD$ ~D$fDH=9eH5{1Dd$$H=eL$pD$ 4T$ Y#fDH|$։D$AD$4D$'fATUSHH dH%(HD$1HD$WH{1"IHLdH=UdH5o1#H=@dpHD$LLd$HD$dH+%(H L[]A\Ht$LDH=cH5z1{#H=cOo2HD$rHZH9\H1H5,1HHt[HC~OsHT~@Ht$H3~/H'H|$1H|$IMH= cH5cn1"H=bHn3HH<$ t  H=bH5y1+"H=tb9nE{ff.USHHH>[HH;HHHHH[H]ff.@w9USHHH>HH;HHHH[H]Off.@75UHxAHHH=paHlHE1 !H=Sa11Ҿ ]HmSUH xIHHH=aHlAHE1 H=`11Ҿ D]lf.UHlHAHglHE1HHH=`I H=`11Ҿ ]lfAWfE1E1AVE1E1AUL-O ATLU1S1HdH%(H$1f$HψfD$,fD$fD$fD$)$)$P)$`HDŽ$HDŽ$HDŽ$ DŽ$(Ƅ$.DŽ$HDŽ$DŽ$h DŽ$Ƅ$DŽ$Ƅ$HDŽ$HDŽ$DŽ$)$pHDŽ$DŽ$f$Ƅ$)$)$)$)$)$)$)$)$)$)$ )$0)$@)$P)$`)$p)$)$)$)$D$ HD$$D$0D$@D$XD$PD$$D$ D$`D$8HD$HHD$( t@== wHbHcH>D$8uH=pE16H=]H5HI=l$HfL8ExCxHHCHn8H-THCƄPHH=kL-HnHH=jIDHNHCƄPH;^HH=jIDHHCƄPH+IDAL*D9DLHIH5H HHCHnAL=8H= hH-SL-HI?IHCHƄPH_IDHFI9uF@HcH>D$0D$@聪E1E1:HT$H=[H5Fi17HT$H5ZH=t[1E1E1H=`[L=SD$HD$HD$HDŽ$D$0D D$`@HT$H=[@1H5he@ӼD$PHT$H=ZH5^h1mD$0$HZHD$H{D$$=w_H=hZHT$H5,uD$0=MfLh2fD$0teH=ZE1E1L=QD$0D$HD$HD$HDŽ$H=L1H-H=ZLH=t"H|LHH9ۜwMtH5 L}1H=#H-t)f.H|LHJH9wMtH5%L-D$$t:D$t2HL$HiNHiHOfH}HN H9u닄$H|$LH|$HH$H$VH|$(9LHH9u~ (HH9uHHt2H$1HH>9LHH9u~ (HH9u\$8bL$M )L@'D\$$E&DŽ$L$$|H5NEAĉD$MiNLHD$H&H|$L1sD$ H#@=^=Dx@D$HL$L%\HYLiNJ1OHD$hDT$$EtPHHMc|H5cML]IH<LC|H5?ML9IHt<HcD$`HSLC H5MIHHD)HS|HLCHC@HCHIH;Lx|H5LIH<L|H5LIHV<L|H5rLoIH(LHNH9\$hDL$PE'HD$L` J0O0I<$L1IN螼I$L1茼I9tI<$LI<$LDCAƄH5,LkXEWHT$L1E1H=JH5YE1G +fD$Af$CAƄEAƄEAƄ=CAƄ&HAH$f$Af$Ƅ$ADŽ$f$Ƅ$ADŽ$_HADŽ$H$H=YIH5d1E1ƄA11ƄArH|$H1Ҿ蚕|$x$HD$HH$HD$Pu$) $, D$0 D$@"DŽ$HD$PH$/8$HH9u bH5$@l$`1L$0L=9@TL-ſ1T(T;D$ HI?4$uOLWHT$|$$LHE$0HSL$ۿHE$0H|ff1H+SH*H*^D$hD$h15vS2l$`$LS1L$0L-3S*S;D$ HH=84$sMLUHT$|$$LHE$0HRLA!ۿHE$0Hyff1H+RH*H*^D$`D$`5wRDE($IR1L$0L-0R'R;D$ HH=74$pJLRHT$|$$LHE$0HQLAۿHE$0Hvff1H+QH*H*^D$`D$`5tQDE($FQ1L$0L-!-Q$Q;D$ HH=64$mGLOHT$|$$LHE$0HPLAۿHE$0Hsff1H+PH*H*^D$`D$`5qPDE($CP1L$0L->*P!P;D$ HH=54$jDLLHT$|$$LHE$0HOLAۿHE$0Hpff1H+OH*H*^D$`D$`5nODE($@O1L$0L-['OO;D$ HH=44$gALIHT$|$$LHE$0HNLAۿHE$0Hmff1H+NH*H*^D$`D$`5kNDE($=N1L$0L-x$NN;D$ HH=34$d>LFHT$|$$LHE$0HM LAۿHE$0Hjff1H+MH*H*^D$`D$`5hMDE($:M1L$0L-!MM;D$ HH=24$a;LCHT$|$$LHE$0HL LAۿHE$0Hgff1H+LH*H*^D$`D$`5eLDE($7L1L$0L-LL;D$ HH=14$^8L@HT$|$$LHE$0HKLA ۿHE$0Hdff1H+KH*H*^D$`D$`5bKDE(@0$Y0I R$tfHD$L=thH H(L,(IܺLHI$H_v JH;HNI9uHD$E1L=K0L,(H$#HD$hHL$hAD$2vB=H5W1D$$Hu$H=<H5 YE1E1INM9m2Hcyt$*;$+H1L$0HeH.H=.4$-LHT$|$$HޅHE$0HhH{-LAHE$0Hff1H+-)HH*H*^D$`D$`5GD?GG;D$ 1$)# H$H DŽ$ t$8t@ H$H$H-cG/GtHEH95PvH P-1HL$8w$FHRHHEHD$8HL$Lt$xFJ1(ON10OH8HL$pHD$`1H`H=!-4$Ld$p@rF-D5aFE=JFI$tX1ɺ !FI$v&t!1ɺTI$IL$11ALE=EI$L$ DD=EEt'1A H L蝔 I$EH0It$DLHlIt$I$LI$LI$x裯I$HH,H$E1E111MI$1D-#INM9c8I$HHAupDE1ɅAH$E111I$1I$|H5%9HcHIHPMt$I$LKsIL$11AI$LCH5IH=7H=7YCHL$BLd$`H(H `HI܉HHHL$pIa LHIN~IL9t$`uD$h5ADpAgA;D$ Lt$x$,.$-,$.1HD$HhJ0OH}$,HNH9u@HD$J0HOHL$`J0NJ0POH $H$HL$pH skHD$x1HL$8@@7HDŽ$(t҃|$X2+WIHtH_8LH$%HDŽ$H="4H53[1H= 4蘚?H=3H5Z1H=3m??ƄH=3H5WZ1`H=34n?H=3H5Y15H=~3 w?=?HL$pHH)t1HH9rH$(;HNI94jHL$pHNI90jHL$pH=2H58OHD$HL=*H=2[D$0HD$D$ HH`LHHL$H$fHLHL~HLj1H$6L4$fI}I#I}0I}hIM9uHLLHLLt$I}IM9uHLHHHI}IsI}HjM9uLkI}ISL9uH;E1LH{H{H{H=ttuI}IIIpIIPLILߨI@L˨L95 twE1H=gptNDJJ&vJ.iJFLIpL95pwH{ LHNINHH0L4D$ D$ HD$NH$N;D$pE1E1H=/H5w1H ?HH5o/1H=G聎H=/H51H;L=N'HH^… Hcغ|H5.H}IHLH趹E111LH\sL=%6HLL*H$0 H$H|$HD$@HD$8L$0HD$0D$XHD$0H|$@$AtP*L2tH$0H88D$VD$EHD$PL HL$8H$0H$@{8D$h8 J8ED$89D$HD$0L HdHMIc\HA?HDŽ$0H$8H$@DŽ$H+ L\HH  HؾffHt$PLH яD$XH=;GLT$`T$`HÅtH$0ff1H+/7H*H*^L$`=[nT$H6H55D$`H=*H HDs|$XjHD$0ffH 4<*D$^D$`A*LYHHD$09D$ ~=mH ''"H=;1L%7ALL1H=&H9\$ H5& 1L%Y7sLD$@1H=&H:Hh;H=&LظHV9\$ H5i& LL蟡H|$PL荡HŸo5D$0<H=\)H=91:H=.G1H %H=9L%O6ALL1H=%H9\$ H5% E1H63HL$@1H=p%H9D54R4$H :H=I%Bf/$vdHX9^RID9d$ =kH=:(H581o3D$0HھH=J81趆H=8襆|H=E1蒆OH 7HH5\'1H=?nH='H5KE1L=G=H= E<H=D1)}H h7LH5&H=?JH .7LH5&1H=>D$ L-OH PD$ H H57H57H=&1~H=&H51H5ZH5$EH57H5DH5DH=i&1E1E1H5ZBH$H5BHH 4LH5%H==ׄH|$P1L=Ƅ$,Ƅ$)I<芷u HD$PHH u I{:dH$0H$E1HH$0sH$(HkHNHg.H\$HH71H轟Hc$(IcAH@HAXD9l$ H\$LI迪L;|$pH|$`L=,$LLl$HL$0H=f[yLt㋄$0ƒu <~H= H1N9l$Pu=ct.H5qH1wH6aH53H1wH HHD$HfH$0H$HH$0蠩H$ HKH{Hs1HLc$ HILl$8AXEAED1HʝAXEHAE&1H謝AXEHAE1H莝AXEAEH$0H$HH$0ͨH$ HxH訨H蠨1H&Lc$ ILl$hAXEHAEq1HAXEAEkH$0H$HH$06H$ H.HH H1H臜Lc$ IL$YH$0H$HH$0辧H$  HiH虧H葧1HHc$ HXSX~H$0H$HH$0IH$  HAH$H1H袛Lc$ IL$tH=2H591D`EH$HD$pH$HD$`H$HD$XH$HD$xH$HD$hH$HD$8H$HD$PE1L-ODII\HD$PDB< tOtID _ELH5O/1s5EH[Dt$ 1;(H-)H4$.H5p)tOls ((D9sLHDf/$H_wH5*)H))HDH5,^SEs렿 2LH5.1r.H$L5{'HIHH$H=:?1zL%QH-\W1('UA\$AT$DH5.AL$A$MCrHI HHHD$pA݀<tD&^Eu= ^A|$At$Al$A$$Ug!DDH5>D C^^^^qSH=/H5)1|HrH5$>1`q%DL%P1HB%HD$XA<(tE5%!]D DAL$A$H5,pIHH{TL%hO1`%IH+AL$AMDA$H5U,pHIIH HD$xA<(t܋$Y\uO\A\$A$AUuIMrBH5= ^B^^pzH qH57=1ou$ [A\$A$ AH5=f(^^oHpH5=1jo$ #E1H-MH }A DBDH5*^oIHI HD$hEB< tD5#ZEu ABDDZf(^EuHKf(ȿf(H5<nHoH5m*1yn#L%LH-Q1"HD$8A݀<tKD"LH5;f(f(^^^alkHtmH5m(1Bl  x>BD='XS f(^Ѕxf(H55(f(¿k|HlH5u91kc D WA\$A$HMU Et= =H59^^mknH=S{D$0L-&E1H$H-KD$ HAUD¿AMAEH5X'jIIL95GS B<3Et|$ uڋnNdVuVAmAeA]z <LH59f(f(^^^fjkHykH581D4$CjD$zHHkH581D4$jD$D kH=H5!L=: 1,H|$`rLz=UF$ $tl$L= H|$``LcUEH5!H LH5nH=)pH5!{:vH$0H$HH$0AH$ H9HH1H蚏Hc$ H{FX{:H$0H$HH$0šH$ HmHL-#薚1HHc$ HkIHAXEAEi1HAXEHAEK1HюAXEAEEH$0H$HH$0H$ oH軚HL-:1HjHc$ HkIHD$pH 1H5H='nLD$pHD$pLL1H5eH='ynLD$pbHD$pLL1H5;H=d'OnLD$pDH=yH571L=HD$HHD$pH I1H5H='mLD$pzHD$pH 1H5H=&mLD$p!Ƅ$Ƅ$*}@HD$I RL=%8H H(L$(IݺLH萢IEH1F H;HNI9uHAT C1lHT$|$$H5z臆HcJHH5H$H=*H=3AL H HD赯f$5*H '%HH^ 1f.H=L1_H=3VmeL$H=WHkHP H071`HT$|$$H5{{Hc><HaH5$H=HkH=p2H HDLHڸ襮f$*H$HH^ Ld$ML$PIL$AIpIt$LMINL9$$u|L$H=XHkHP H0+1THT$|$$H5zoLc20H}H5$H=HkH=d1H HDLL虭f$A*H$HH^LHO1H)HT$8H6H=H5 10H=yTr8ƄH$0McL5A(L$;H5H=M;L|$8HkAT 1~HT$|$$H5/x*Hc}H5jHH=D$8Hk=)0AL HHD[fD$85*H0"HH^ ¸ 1H)HHT$hHsouXHfDL|$8H5 H='1ЫH=RDNHrHHDHH)HHH"H1H<HH9r L|$8H5<lL|$8H5 [1H)HT$XHxA@AAL LL-oH(L1H5[1DD$xL$L$L\$87~HHH|$81ҾNt$x1HHD$8N1DLHNH$1ҾH$NH$1DHD$xNH|$8H$HL$MH|$xkH$\4nIHKLH5ZHE1EHT$xH5=LDtuH$H5~KLDtZHT$8H5fLDtBHH5>XLDt,LyIHtHRj HDŽ$0LsL辀H|$8$HH$H|$xH$H@H$0HHD$L`PD-3H1YKID$I$IHH\IL$ALIt$IDWINL9d$`zL$H5H=QL$0AWчLٔHT$|$$H59jHE$0Ho~LHc؉T$8蝔T$8HE$0HD$8_HT$8f1H+%fH*H*^L$8Hڋ5E+D$8H=A H5 H0HDbHL$hfLl$*^D$8HHH1HT$8XHT$8IPjIPH FIMA$IUPIuIPnINL9,$ uE1E1TAAL _LL-qH*L}AAL KLL-=HLIH$0L麇HDH=YH5j1˝H$ىH5H鯊H=#H51E1¥馊H=E1E1L=LD$DŽ$HD$HD$Hf.L$L5<6H5LL$0HT `ڄLHT$|$$H5bfHE$0Hx{LHcIH$蟑ۿHE$0H\ff1H+.H*H*^L$hDT(H5D$hH$HEH=L HrHDdHL$8fA*Ll$^D$hHHH$(1UIݘpIŘH]ƣPLIMA$IUPIuIŘk#INL;,$uH؋L$H5H=z,HT 輂6L>HT$|$$H5hHE$0HyLHcIH$ۿHE$0HS[ff1H+H*H*^L$hyWD &H5XD$hH$HEH=)L HHDHL$8fA*^D$hHl$hHHDHD$LhXH$(1lSIDxIEIEI|xHFTٮIMA$LIuI|xqsINL9l$xuHl$hH؋L$H5)HH=*T L茎HT$|$$H5jHE$0H"5xOLLcD$LۿHE$0HYff1H+H*H*^L$hʜLD$H5D$hH=HEҋL HHDD-cHL$8fD$H\$LHA*^D$hDH$HD$hH$(1QJHCHH$HHPCHKHsLCXHHT$hylD-HNH;$uLL$H5ZLHT KL͌HT$|$$H5iHE$0HcvvD5LHc蔌EHE$0IWff1L+%"H*I*^L$hHDE#H5D$hH=HEۋL HHD]HL$8f*^D$hHHD H5H ELH51H=.>@INH R_M9: 1L%XH~4s<H~H=4$[}L$0D=,~LLL$h/EHT$LHE$0|$$Ht}H|$hAljT$`T$`HE$0HD$`FVHT$`f1H+|fH*H*^D$`gD$`5?D s,HL$H(9D$ 6L$AH5RH=|D-2}L:HT$|$$H5cEHE$0Hs |LHcIHT$xL$8L$8HE$0IIUff1L+%H*I*^L$8oMHT$xH5= D$8A HH=HD远 HL$hfA*^D$8HHD 1H)HT$xHH5 H=1eH=9CmHL$`H)HH<1HO1HH9r;H5wH5FH5H5 |H5pH5dH= H5YZH5EH=H51裛OH5H=H5>1w#D$@$1H=;L$BH;w Ptڀ$uH 2L,HD$H$fLHDŽ$0)$)$)$)$)$EHgCA}EA}C7H`H1LH=mIHHIxtH$L lH$0L5rHH$0H==HH}1H TkC$wH5!H}^<H$(11HL$ IH$LKc H$ |H5HH$H$HIL$(|H5ULL$GL$HH$L$LLHH$b>HH$0H=H$0MoH)HH PHHfDfDL$RD$0$1H=L$#BH;Ytڀ$uH L$0L$HD$H$HDŽ$0fA)A)GHDŽ$()$)$)$)$)$S3H LbAHg A<$dMHE1LH=diHHHsEtH$HgH$0Hm=DHH=LsHP{HH$0H=E9IH4DLHH1HL\zA1H$ LLA P1>L$ |H5LL$H$HH$A LLH$0fHH$0H=A)A)GR8IHQCLHD1HLo@/zH$LLH$A \H$A LLH$[H$&H$ H$0HH6H$HH>H$L&L.HFIH'7H$NH$H9 $Dt$H5LDr1dHl$D|$$H5aHDiLcbd=LHQH5WH=CLLHDD$L-ҒfDL*D$ H5Dt$Hk^ALr1cHH5gVDhLcc=LHH5H=L$HD9fɋT$LA*΋w$H5NHk^ALq1HcHH5YDfhHc)c=HHhH5BH= L$HD蠑fɋ $*HȉHkH^AL fDL$DE$ѴH5;1(q1HDHpH5EҋHE1(7.;D$ r q\軍H5;"H1U(蛍HxaH5H1((nHx \Hx$ݳ=H=2]xH5X1'H=^LH51H=F6H$0*FH3 H)HH Hs7u HfDDHyHHDHH)HHH1H|H=LH5A131H=wLH51H=ZLH51LH \H5H=-H= L1H5<迎H=LH51袎DL[bhH=LH51kiH=L11H5LJR^H=L1H5*(H=nLH51 ^H=LL1H5H=/L11H5̍A|$sEt$Aa1t8HHtfHJ~Z1I|$ nHP~;H$(H1~'H$(12>HHtH2kBH=sL11H5UL$H$L1LH5=UAƃH$LH59HA@H$ HH5PL+9HH5VYH=H51kH=?3y&H@L$Ht$hH=wAT RkD5kLxHT$|$$H5SEHE$0Hh{b kLHcIHT$hL$8xL$8HE$0ICff1L+%H*I*^L$8@H5ND$8H=H@HT$hAL HHDSfH$A*^D$8HHDL% H-6L1LHH *H=HL1H5\fH$&H$0HH$ HH$H L8HL( LHH@H$NH$H9 $jDt$H5LDi1[Hl$D|$$H5IHgMtL1Ҿ7HLLLmHHL[]A\A]A^A_Z@f.HBu HHt uLHHu@%= u==uHH=H51r"H:AHaHIG?bXHL[]A\A]A^A_E1I=t)=uH{fHx@Hh@HX@L>fDAUIATIUHI!LLH jIHtAL]A\A]DWL]A\A]f=mtHWfDATIHMHtyH=*HHtJE0AEtHA\ÐH=H5rf1HHA\fHD$flHt$HHHtLH5H=1H=A1AU@ATUSH8dH%(HD$(pfHHcH>@AHD$(dH+%(H8D[]A\A]L%H-\HLmIH=HiHHH@HD$>I9rfI9HKHDJ uHD$HD$HDJ u:LHHPHT$1A}IEH$HD$8H=HH5D$fAąMD$HL'@HD$(dH+%(7H5]H=6H8[]A\A]gH59Ht 1>HDHD$(dH+%(H=H8[]A\A]!%HAHĮYE1fHD$LH5m1E1H=|HvH$H551E1H=DH$LLl$HL$H$H51H=7X>ATIUHHH(HLeHt3I=HL1ocff.fAVIAUIATIUHHLLLH AąuHHD]A\A]A^@3HD]A\A]A^ff.AUI1ATUHHH=dH%(HD$1H$=HHHIV~"HD$dH+%(HL]A\A]ÐH $H=ŢH^H~9H51[bH=Mt9LH51>bLE13?돐H5<1"bH=kMuH5^1bq2AUATUHSH:1H=HYHI1HL1;^IHu2fDLLH.2I4$1HAtLAŅ)fI<$:H5FE1(I$HT fDE1H$dH+%(u[H D[]A\A]A^Ht$HC@I$Ht Ic1H;D$tH=D11H5yD^_.H LH5H=B-ff.fUHSH,Hƀ,tCHfDt]H,t'DQ tuUHҺHDH[]EHEH6HHDN uff.fAWAAVAUATUSHHL5vH$`T$8H$PH$XH|$@HD$H$hLD$`HD$H$pDL$\HD$PH$xHL$(HD$ H$HT$HD$HdH%(H$HHD$0H HD$(H|$HmHD$H|$HL-HD$H|$Ht HD$HH|$PtHD$PH8gHD$ E1HtHH|$Ht+HD$HH8AL$AIAEAAHD$@H$H$A HAHl$p1H5jHH$H$oD$pHo$H$)$)$oT$po$H$H|$@$H$$^jH ILjHt$@H|$PL$2AYAZHHEHD$PH D$HD$lL-D$hHD$8HD$ H D$8H\$(Lt$HD$0H \$L t$HuMu H|$0GH:AądH,IHtH >Aƃw;IcDL>H\$HtLMHHHD$L@L@H\$HtLv*HHHD$H\$ HLHHVLD$ly@HD$ H\$HLRGHHLD$h9@HD$H\$(H L HHHD$(H|$H|$YL-@H+A -A1H|$@l$8D\$\EZH|$@RE1D$\un(E1H$dH+%(QHD[]A\A]A^A_f.L(?D )t$\IŅ5H9RM(>fH7HD$H|$L-HH|$HD$PHH|$ AHD$ -DH\$HHLH;HD$l0H\$PHLBEH;1H D$hL'>f.HD$ HD$HD$HD$HD$(HQT$hHt$P1L-L$lHOHND$HH|$(Ht$PHD$Hn|$\H=,H51VL|$`HMLL}H=HLH51VHD$@HtH=˖H1H5SjV6H=H51IVH=pHk$J@DH5J|$\Hl$@%H= 1B8H=1 IHtxHLHLcjH5jSHT$PL$OH LH>"HHD$@bDH=H511aUH9OHHD$@DD$\E2HD$@ZH=u1H5UHNM8H|$d?HD$H|$L-HVH|$P^HD$ AHmHE1^H|$lHD$PHH8`L-OHHD$HH(H+Dd$\EH=H514T߁H=dH5k%H1T9I@+OHL$PHHDt$\EH=H5F11SOLH51SHT$`H=1H5wSH|$L-H|$L-`lH|$L-YL-HIH|$ L-6HL-\!H=QH511RH=5LH51RCHD$PHH8;MHT$PL-2HH>DH|$tzHD$H|$PHt HD$PH8t8HD$ L-AHH=H51RgMHT$PHHuL-b4H|$PtpQHD$PH8HD$ L-AH'E1H|$ L-NyL-AH|$ L-/AuSH|$ t#HD$ L-AH(H|$HtuL-A!LHL$PHHAL- MAWLHL$PL-HH%Hs#E1E,Ht"HT$@H=!1E1H5PH4HD$@ff.fAWIAVAAUAATMUHHdH%(HD$1H$Ht-H5KtnH5?HtvHE1MLjDDHjjHD$ PjjjHD$@H@HT$dH+%(uwH]A\A]A^A_fH=)LH5OH$@111HH$HuH=}HL1H=ޏH5OH$y@AWAVI1AUATUSH8H|$LHl$pHT$HL$1LD$ LDL$,IH1L-Hu-7DHn)LLHIH9|HH-L|$1Lv HL$LLHADž8HD$Ht HHHD$ Ht HH2Hv MHLDH=L1E1H53NH6~"LH8D[]A\A]A^A_DE1H=NH=9LH51E1MH=LH AŅWH=LH51AMD$,HH#,HI5H=H5D$1OMDH=H51A/MLA9DL'H=TDH52I1L=tH LHL$vHL$H=ډ1H&D;l$mH=H51LSMHH=׌H5LD1E1LoL?f.H4MHH=LDH51L2LLD|$,ff.AVAAUAATIUHHdH%(HD$1H$Ht-H5WtsH5H?t{HE1M1jDDHHD$PjjjjjHD$@H@HT$dH+%(u}H]A\A]A^f.H=LH5':KH$@111H*H$HuH=bHL1H=NH5JH$sT@AWAVL5AUIATLE1USHdH%(HD$1A9@DL%HHHh fHE9H$Ht$H|$IuHC~LBIHtLHuHD$dH+%(uaHLH 51[1]A\A]A^A_f.LAA9HD$dH+%(uH1[]A\A]A^A_DAWAVAUATUHDIHH911ҾgHIc HIhL=LHL>Ht^HLtO11ҾYL HI#LLHU>HtHLt]LA\A]A^A_@HHLE1]]LA\A]A^A_AUME1MATAUH dH%(HD$1HD$t_HE1DjjjjjjHD$HPH@:LH5oHD$HT$dH+%(u:H ]A\A]DHLLHL$L $HL$L$HIvXAWE1AVIAUAATAUHSLH(dH%(HD$1HD$HAILjDDHjjjjLT$@ARLT$@jH@LT$H|$t[OH5uLHD$HT$dH+%(udH([]A\A]A^A_HLLHIeHE1ILjDDHjjjjjAROH@s1AUIATMUH1HdH%(HD$1HD$jjjjHD$(PjjHD$@H@HuHT$dH+%(uVH]A\A]HH,t H$H= LL1H=mH5FH<$X1off.@AWMAVAUIATMUHSHHLt$@t5H5H5HLLvHME1jH11jHISAUjjjH@AMtL)HkLHb9Et}MtIuL1HL+1 LsLHH`L9|fH=)LH51E1DHD[]A\A]A^A_H;Hff.@AWAVAUIATUHSHH(HL$dH%(HD$1HD$?IHHL|$HIH1Lt$LMI1HZYLt$tdLLJ,t;LNHD$HuHD$dH+%(uEH(L[]A\A]A^A_E1H=H51CLLE1뱐E1fDUSHH H:j@E1jR1jjjjH@u@u H[]fDH;D$ HD$ H[]f.UHH5~SHHHuH[]H5HYuH[]H5H1A1Euf.HH AWAAVAUATUSHuH[]A\A]A^A_ÐHHE1?ILA9fDDLmHIRHHHƃt/At=fHHHHPƃuٺLHytLAiA9xH5LD$ 6D$ H[]A\A]A^A_D1ff.fAVAUATIUHH=܂trL-˂HuH]A\A]A^f.L%H=1L5QMtILHLHLH]A\A]A^DHtHAL51fL1HHIxLHmHL4]H5A\A]A^fDL5HL6Sff.ATUHSHKuAău[]A\DH/H H=)H5 HIcHHH=IDH51?[]A\AWMAVIAUIATUSHL$DL$ H-~IHlH$MMM]|$QMu$t$ tHL[]A\A]A^A_DLHHHt@H1LIt$E1CZYuH=MtLH5;>fH=~tLE1)u@;LHpHHtMHLIt$E1HZYHIE1t$LH߾AZA[H=G~LH5N1=H=/~Af.8LHHHE1MttLqH=}LH51z=H=}fDHIE1t$1ҾHAXAYD1ҾfAVAUIATIUHSHHdH%(H$1)IHHAD=IILHtL1,H5LHH1LIHHHAH5HUHtL#E1HLH$dH+%(u~HD[]A\A]A^@H=Y|H511;H=B|E1E1D=ILLv&H= |H51; @AUATIUHHt;1ɺH't0Mt>LHE1HAHHuE1HD]A\A]A1ɃHD$&H|$At'AMtLH|$E1H|$HAHD]A\A]ff.@SHH1LH  tfu[fH{LH H2uHCH=zH5HH(HP L@014:'fHCH=uzH5HH(HP L@01 :H=Tz1[ff.AWAVAUATUSHH $H8H<$IIHt$dH%(H$(1H*HI1Hl$ HL ADžtYx'HL: A9uIcHr HMtL9vL1H$(dH+%(uzH8[]A\A]A^A_Ð11Ҿ LHL$1LsLH|$H $HGHHHL$HHG[{1s$ @AV AUL-yATIHLUHW5HtL:HHE1HtHPHL*AƺLHHD]A\A]A^Aff.ATIUH]LHHH=DxH5HHD17H H=HH)HH=]HA\@AWAVAUATAHUHSHH'EtAuAuH?)tHD[]A\A]A^A_fHtG=xAtL-xHH=VwL1HH=BwH5^16LcLHIHAC+MEHHHH=vHDH5p16+tdJ% 'ADIAA"E1%AfNE1AfDHADAVAUATIUHHS6HHH=LkL5w|LL.IH111!IHI)CHQH9wFHH9t A,uH9tJHH)Hw[HAHH)A)HE HQH9vH9sUI)Lm[L]A\A]A^HFHHE1[]LA\A]A^ÐLLǺb`E1[]LA\A]A^LǺmLAE1H LH5t1H=ff.fAUATUSHxdH%(HD$h1HD$HtPHIIպPHt$HH6tQHt$HLIjH itLLWt(ZYuD1HT$hdH+%(Hx[]A\A]|$UNDEu1f|$FLDLl$1Hu+DH>LHI~H9|H=sLH5A13H=sdKf.AWMAVIAUIATIUSHLL$HŅt?HtLLLHyE1H)HD[]A\A]A^A_@L#tH\$ALH CHH諽tLLD$~T$E1HH ʾLH̾AhAZLHE1jAAff.@AWIAVIAUIATIULLLHHE1k~HLE1AH']DA\A]A^A_ff.AWIAVL5AUIATUHS1HHu)3DH LLHI~9Hf9|H qHqLLH[]A\A]A^A_-H=qLH51@1H=qH[]A\A]A^A_H=5n`H=nPUHSHH= n5HcHXH[]ÐAH=mAtiAUATHWIHtAH=#IHt-H LHL1ҾOHIHLA\A]f1fATIUSHMA<$-C<HHrwY1a.LVHux8]H Irt!H wwtaH HHDH=oLH51u/A|$Mrtu0HtIH[]A\H=Wl tHD$ HD$H[]A\fD8rHHH=;oHHH5_HE1.H=oH1[]A\H5}HHDH5HHDH5VHfHDu H5uoH=@[ff.AWAVAUATIUSHHHt$0D$HT$8L$ HDD$$IHnLL$(E1jjH$Y^HT$ HŅ4D$$xD$ E1HRH>IHfHAD-IAPH5m1DDH8%H=%A2JcH>$a$RfLAHIH`H 8$H=mH H5DD1HjHr&*D$ HH[]A\A]A^A_D$EgD$E>LAbHE1E1jH=H11_LAXD$ED$ELAH=HL{fD$Q$LAFH=gHL/vf.$$BLAVH=HgL&f.LHD$LHD$LL$DDLD$H57kI1H讪MtH5kLD1H莪H=u)H$1ɺw[HlH[$lLAHHAE$$$Pj$P$PLL$hDD$dL$`HT$xHt$pLD$LH@H=TjH51A)LD$ KH# D$ LAH=HLMLH=YH) $ZDLH=)11He$&LXH=11HD$ELH=11HD$EyLH=H$Dt$ HH=hPD$ H=h4D$ f.t$$Ht Ht$(HScfH$H=QhH5:'D$ NH=)hLH51'H=hD$ %HH=gH5'H=gH5O1p'H=gDD$ H$1ɺwHHD$ fDAWL= AVLE1AUE1ATL%uU1SHHdH%(H$1HfHD$xHD$`H0Huh萻D$@HD$0HD$8HD$ HD$XHD$HD$HD$HD$(HD$HD$DD$PD$Ttw|PwHcH>w͉&uE11AwfT$@f) DD$@uH=AD HeH|$8Lc=qeHD$hHtHt$xH|$HHMtL1eIHHD$hIAL$H$HH5fJHHLIL]A\A]H=_]1A\A]DE1]A\LA]@AWL=AVLE1AUATE1U1SHHhdH%(HD$X1D$LHD$P?D$0IH٬D$4HD$H HD$8H8HD$(HD$ HD$H$HD$DK;|wHcH>H= _HT$LufDH=^L11H5\^A1E1E1E1L =H|$PLL$L$H<$bHLLLrHt$HHD$XdH+%(HhD[]A\A]A^A_f. 1AEDAD1AH]H1ƴHHGH=]11E1H5`E1AgE1L D$0CL1E1fDHa]HD$HI]HD$8H1]HD$(H-]@H ]HD$H\H$H=\1Ҿ}IDH\HD$ oH\HD$WD$4CH<$CH|$HtHt$PdH $t$L9-u1yHEH$H<$MHL wo6IHHHAH|$t&L|$LHLHzLHHT$PLHȼHIHH|$ 1ɺwHLHHD$1H5E1!L ٨LLL $fL|$L $E1wH|$1IH;HT$(Ht$8HH$L$HIHL$L$HH&H|$ 1ɺL$w1E1E1AL f$1E1E1AL L E1E1AL 4H=Y1E1E1H5NAOH=Y#L$L LHhL$H=eYH51L$HHL$HT$(H=.Y11H5E1AH=Y虿L$L m+H5LE1AL L L @LHD$LL $E1AL $LD$E1AL H=XH5E1L$#H=lXDd$4L$L ƥmff.fU1Ht$11~7H]H=WHHu4]H=WH51H=W_Hw1]Hff.AWAVIAUATAUSHL=vWdH%(H$1HDŽ$ HHnL-HtLDLHXAH3辫D$@DŽ$ID$D$tDŽ$D$pHD$hHD$`HDŽ$HDŽ$HDŽ$HD$HHD$(HD$8HD$HD$XHD$ HD$HD$0HDŽ$HDŽ$HD$xHD$PDCDž|GwHcH>DD@@#wu1AE1L=f/yHtŃD$諾Džh19AkBtH|$0HtH$WwAu H|$H11LIH;H=.ULH5W11HWL HUHD$0H|$0H5HHx HD$0-H|$0ӽLkL9=TtLbAAA)H|$H|$(-H|$pH|$ DT$1H|$L%LEHEHD$8UHD$0HG DL$@H|$01EHD$H HD$HD$H D$ HD$(H[LHHD$H1HIH1HIH1LĵH=SHD$(H)SHD$ GIHH5HH|$`t; LHHHaHT$`E1H|$PtH\LHHHVE1t$(LL$8HT$`_AXqH|$htDlLHAHHP1E1t$(LL$8HT$x藬ZYKHt$8HtLLL0H|$xHt/HL$81Hx;HHLxH|$L|$@VHt$LŶA1H5E H=H|$0L=ě詺H|$迱H|$L转EAEBAAfD1E1H=LQLH5P1AL=YH薾H$9LtLHH$dH+%( HD[]A\A]A^A_DD$p{HPHD$XgHPHD$ OHyPHD$7HQHD$0HIPHD$xH1PHD$hHPHD$PHPH$@LHvCL%|HcCHt#fDH=OL1HsHHu1E1L=ՙE1yL=OL@HyOH$4@HaOHD$8D$@ H9OHD$DŽ$H OHD$`HNH$@HNH$@HNH$|@HNHD$HgHNHD$(OD$t;DŽ$(;nH|$H12HHH=?NH51E1AL=L LH5BH= N11E1 AL=HT$0H5|M1E1H=苘sLH5D|$EYH|$t H|$ EH|$L$H1ɺrHD$H H|$1L={蠦HD$(IMDt$t1EH|$8wIHtLHD$H=L|H|$H|$(LLDd$AH=L>$D\$E>HD$H5H|$($H H|$H5HD$H1|$@H|$IH]HHD$H<IH IHt!1H tLL LH|$%LE1LE1/H=KL=Ǖ,H|$袴1蛴1蔴1荴L腴LͫDd$A1H=XK|$@H$H|$(H5HD$UIHH$LIHIHHHҌLLתH$LLH$LLLvH$LLL蠼XMHLLH$7HD$H HL.LLL踮HT$XLLLLLLgLLLaLLL LLLLLLwLLLyaLLL#KLLIH4LLTH==IH5×11Ƀ|$tH|$8w~IHS$}LLLHAD$!H51E1HD$HD$H=E1yH=HH|$8wIHz$L肾LHD$H|$8wIHLHD$HD$(H|$ ^HDŽ$M0+IH7Ht5HD$0IHCHD$HLIHD$LMYIHD$L@MAHLHt$ H|$(LH$…H$LLLxH|$XHS1HHLHD$ ݣLD$ .|$pH$LD$ HHD$@FLD$ x1HL$@D$ <HLD$HLD$HHIHHxSLD$PL=JL,L$ A |H5F)A)AMcLL\$HL\$HLD$PHHHt$@IcIFHcD$ LD$HH5LL:LD$H7$LLD$ iLD$ H|$0LD$ H|$CH$ L^H|$ L|H|$uGHD$H D$(H|$ )HD$H&HD$H|$(E1E1HD$E1E1IH{D$E1E1E1E1H|$1ɺrHD$(H~HD$(E1E1L=sHD$GLHD$tE11E1vLE1LH=CH51D$2HT$`H=CH51wLE1 lH=CH51RH=$IHE1E1L=E1HD$HD$0LLD$ E1&H=OCH51H=:CũLD$ H 1LH5B1H=Z̡HHD$ H=B1LD$ E1H5L=}1LD$ VE1L=،HT$XHD$ 1E1H=BH5L=4LD$ E1E1L=E1E1L=|HD$E1E1L=aHD$E1E1L=FHD$0HT$hH=BH5C1,螫IHtPHD$HLHHD$HHL$HD$RE1HD$E1E1L远H|$腪L=H51E1跘H=KAH5(1HT$PH=,AH561RE1H|$E1HD$rE1jH|$ H$_H$LH<E1J6HT$LL1Р1L]Ht$LALHD$D$VE1o1LLL覶 H="@H5\E1ff.ATSHHtxHH=?;tIHH5A11HFIHtFH9?t Hmt)HL[A\fDH5XA1:L(E1HL[A\f.AWAVAUIATUSHH5HdH%(H$1VHH1ҾkHL$HfH|$Ht$ HzHHD$L$L1HLL=?L|LIbLD$HIL@HlA$Mt3THq@1LHHOHjA$LLID$Ht{foD$ foL$0foT$@fo\$Pfod$`fol$pAD$fo$AL$(fo$fo$AT$8A\$HAd$XAl$hAt$xA$A$H==L-1覫H~H$dH+%(u}HL[]A\A]A^A_fDKHtH=>胲莕LH֋01FE1E1jDcH H5f<1H=TxAWE1AVAUE1ATUH-SHHHdH%(H$1HD$hHD$`D$HD$ IHD$0HD$8HD$HD$(D$HD$ Dž|GwHcH>DX~ˏut$H-q1E1H貳rH1裳HD$1DaE11IGHxHD$PDT$E^H|$ LHl$`tH|$ AHD$`HED$(Lt$h^qLLrLHH=+LH5d1D$(=1E1AE1HD$L-snH=+H5z1D1LHD$HLt$hHl$`E1H=^+H5<{1=Hl$@I&H|$8dHHT$8H5bH=+1Lt$hHl$`{IGt$\LL$HHx L\$@LL$HH>L@HH8IGHx|$HD$PfIHyeDd$Eu?H|$L-yH-yLH>IH{H|$HM"|3H=F*H5a1L-7yH-8yH|$LHIH'H|$HM{H=)LH5ua1L%,H|$LLHD$ HH=)LL1H5@VLt$hHl$`E1 LH5h+13 H=w)LH5mb1L\$HDD$@ L\$HDD$@H|$8sH H=.)LH5|a1HHl$@D$(1&Lt$hHl$`E1AL-qH=(HL1H5!@|Lt$hHl$`6Hl$@H$IH=(LH5a1HHl$@8D$(:H x8H5 (1H=2@|$ff.fAUATIUSHtg1ɾr菷HHcztWHKx =H}HcH>@1ɺr'HH111H轤IMt+HHL[]A\A]H=u1*rH=c'E1MtH=O'LH5w1@HwtHuwHHDH5&H=`1qH5HtHL-u@HsHHOCtL1wqD1?fHv1HvIHvaH}UHQIH=H(1H}%Hvf.AVIAUIATUHSugH&1ҾH%IH%HtZLRLLHH葳Ht|xxu&H=%H5(`SHXIHu[L]A\A]A^@1ҾH,IHuH=]%HL1H5f_H=9%H5z_[L]A\A]A^ÐAVAUATAUHHH?-AH1}AŅAH5DZIHLIHuB}8ڊH=$HH$IH5/_1H=a$LHL]A\A]A^DEHDH1]wA\A]A^鉳fH5IHtVJ[|E181H=#HHp#IH5^1oH=#CHL]A\A]A^|E18H=#HH$#IH5:^1#H=l#D/f.AUAATIsU1HdH%(HD$1HH$tDLHHt?H$HHpexH$HAH;t'H="LH5]1hH="E19H豋HD$dH+%(u(HD]A\A]@H=y"H5r1脲@AW1AVAUATUHSHdH%(H$1Ld$L越t HD$Hu0H$dH+%(HĨ[]A\A]A^A_L4L-"|LLIHLHH?Ld$1H|$LHtz1E1IcDH=11HT$xL $D$ D$(D$P迁DžufHc 1H01҉T$LHD$`I:HL$htLHH8uT$Lt$xH$MHD$0H D$8H D$@HT$HH=;1E1H5TD$H-CfD$~*`[D @fD/qLzt_D$X[D$ KD$(;VIH[f.HT$HH=DH51D$Lt$xE1H$H-?LLWHLH|$HL2H|$H$dH+%( D$HĘ[]A\A]A^A_HHD$@gHyHD$8OHaHD$07H=I1ҾbHD$HD$Lt$xE1H$H-HLH"gE16H=H5PR1@DA輵HH衳HIVwH=LHH1_躼A9|H=H5R11H-C7+D߃HΒH=gHH1 u9|D$Lt$xE1H$H-ZDD$\D$THH=E11HD$x1L f1PjjjjjjwH@H|$urunH-H|$pE1HD$Lt$xHD$H$u@H=q11H$L詐1&@HL$pHL$ D$1E1E1HD$H-HE1HD$MH5LpH=DDL$ LD$@LT$HL$PHT$0t$(H|$8IH!H5HDT$XELT$H,LT$ 良DL$TLT$ EDD$ED$HL$`Ld$ AH݋\$\L|$M׃HD$hHDHD$(fDHLHAt$LD$LI7/ZYDEIL;|$(uH|$ L|$7LH׃LσH5ЏH|$LE1H|$iAAC?D$D$H-IH5yLaLT$ LLLT$ wLT$ H1LLAWDL$lHLD$M^_tLnLFHLH5H|$LH|$D$ѡAVIAUATAUHSDHtIH5;bL!H1HwHFMtH5bLAąHy11DH訒H'HAHILH諨x[D]A\A]A^H=E1HH5N1q[D]A\A]A^DHHyLH͡AŅsH=H5M1-HLH蕡AŅH=SH5H H$PDŽ$tuD1y HT$H5 H= 1/E1HD$1E1E1HD$@HD$ HD$HD$hHD$pHD$`HD$XH=% qD$H|$X辧LtHNH|$hH|$zH|$@蠥Hh{H|$ ^{H|$`ĀL輀H|$p貀H|$HH|$PH|$TH|$(ʀH-#H|$0H膿H|$8HyH|$x?MtLBu)H$ LHH$XdH+%(-D$Hh[]A\A]A^A_fD=DA=@#]D$E1=FH AD$H$DHD$xE11E1HD$E1HD$@HD$ HD$PHD$HHD$8HD$0HD$HD$hHD$pHD$`HD$XHD$(fHH$@DŽ$DŽ$(H$H=^f.HyH$|@HaH$d@HIH$L@AG$A5DH$kH$[H=H$]Qf.H$L-@HH$@HH$@H|$(0H5m1HD$(HhL5IT@H9HD$?H!HD$@'H=YE1AvD$HD$1E1E1HD$@HD$ HD$HD$hHD$pHD$`HD$X@AD$AD$AG$hAmDAGA$D$L@AG$dA5DAD$AD$H=H$HDŽ$`h?H$D$H$H|$0 H=1޺HH H|$0DŽ$H|$8 H=M1薺HH H|$8DŽ$rH5 HwH$H!hLVH=H5H|$X H|$XHDŽ$H5n# HDŽ$fH=y|AG$4A]DAG$LAEDAG$`A-DAG$HADAG$DADDŽ$DŽ$AG$xADAD$AD$H5qH$$lHUH=^H5GAfDŽ$@@HH$,@H=1ҾOHD$x DŽ$<DŽ$HH$@HH$@H|$PtH5H|$PfDH|$H,H5]H|$H[fDH=9 1$-HT$H5@L% @HH$ @HH$@HHD$ HH$X@AD$|AG$lA}DAG$,AeDAG$0AMDDŽ$8AD$8AG$pADAG$tASaH$Ht1H`T$H$tH$t$$H$tH=ZH51MtL1WIH]HH5H{H|$ "$$B$($H$HLD$x$L1L vHD$`H H|$@H^LD$x$11L PLwHD$pH] $tH|$ HD$@H $HD$XF!MLH KnIHoH|$Lt$hH$MH$@H$ H$ 1H=H581U!H HT$H571H=/H cHT$H571H=^ H=MH521HD$pHD$`xH|$HRXHD$XHLt$hHD$M$u$tH=H5*;1c$H|$ $H|$ LL|gHHtD$H|$MHL$`HH L$pHL$@HD$@$HD$pHHbHD$`HHQ?fDH$HD$XH=H5R91胷{H=H561i8H=H561OH=11E1H5u7E1-HD$HD$@HD$ HD$X(Mt"L$YH=;H5T71ݶ$ui$uHH$tH=H571詶$H=H5 81膶H=H5k71lH=H5 71UHD$1E1HD$@HD$ HD$HD$hHD$X7H$H=TH57HD$1E1E1HD$@HD$ HDŽ$1H$ $H$H$UH$HtHH$ $dH$H$H$1 xH|$(H5(GmH$ H$HD$(HxHD$E1HD$E1E1HD$ H|$`$HD$1E1E1HD$@HD$ HD$HD$hHD$XHD$1E1E1HD$@HD$ HD$HD$hHD$pHD$XVH={11E1H53E1HD$HD$@HD$ HD$hHD$XLt$h1E1E1HD$HD$@HD$ HD$HiH_HHAHHEH$1H=H571kHD$E1E1HD$ rH|$@脀D$DŽ$HH=rH5#DŽ$D$HD$(Ht1HHwHD$E1HD$ HN{HyH$MhH|$(HL$ $ $ $(H$Ht$(HJK|$6M-$H$E11HH$AHH$¥Ht$`H$ H|$XtA$u7Ht$XH$tH$H|$XHH$wgxHW}$, $0H$t H$H|$`H5 6}$$$tVH HH$_R$ZH$ڄ11HH$HD$HL$H$L7H$Lp7$1TI1MH$H$9$cH$ъHH[H$HH$.H$tH$tHLnuH$H$LE1xH|$HD$H5x3H=!1ʯMDLD$x$L1H$L %fIHp H|$ Hi L$LD$HLH$1H{HD$g$@ EH$H"AH$D$HL$HEL$H$f9$ 9$| 9$l? 9$4" 9$L 9$D 9$pN 9$H9$t'9$ 9$d9$,9$09$89$9$M9$hr9$xU9$9$|)9$HwH5gyLHvlL$H$L$|$H$AHtNE111HH蜫H ;H$LAH>HEH521;EAEH$HtT11HHbH ;H$L$H>H5k2HD1D$EA!H$HtR1HHEkH ";H$L$H+>H542HD1聬D$EA!E$ $<$=$HLhD$GH=XH5>1rHH$H$H$HJL$H5>L1覫HL趋HH$H=FIHL$HH$HL|LAWEtuH$L1E1H5IE1#DLA~H5OFLH1eL=SA9|L`rbH5V6LH3HH2H2H2H2H2H2H2H2HqH2Hx2Ho2HT2H)Hf/UHH=aSHtH]]fATIHUHHBtLFHtH^vFH=J3HtHHL]A\fDH}(HL>HtH[]A\A]fDHsLL DH;HŋCHuuHsLL~H;ICMtDH=11DH5)АM=xAtL=aLI^H=L1He)H=H5lEpHcqKH=H5M)H1W1ox D95*oE1oAƃ+wzHDHcH>EMtXH=QH5(Ak=tL%LYH= L1H(H= H5(kEu:HD[]A\A]A^A_fEuAuanuHQWOnuH=DH5c(1ODH=H5(5kn+w)HDHcH>D5mEfDE1EMtAH=4H5I!1֎L|H=HόH=H5$1誎EfMtH=H5 1膎L螀@E SmH?VE1EMuE1EMPE1M"zD~B?~H@u>@tXu)H'tH~H&+t\fttuHfDHZZH&HH%H yAUAI͉AT1EH v&UHLHHHHt[p9uEHEAHR]HH5GHD1DLHR7H1]1A\ A]l/@H =ff.@AWIAVAUIATIUSHDt$P]HIcHD$HtKEFH|$X:HD$XHMLLH5FLAQ=f.EH|$XHD$XHMLLH5*FLAQH1Ë_AXLHD$XH.6HD$H[]A\A]A^A_f.uE~sID$ H8tE1L-FfDI\$HLLH1II$ILCH APM7XH3HZS5ID$ L90wjI|$VI$EL@H @EMLLH5EH1ӊ fDEID$ E1L-EH8fDI\$HLLH1II$ILCH APMoYSH^H34ID$ L90wEMLLH5DH13fDI|$nI$EL@Hff.ATL%A#USu L%4#H8#LD@ui@tQH)#L%#LD1HknH=I[HL]1H5"A\yftt/xE[]A\|$$7HHkHH5x1:x|$ lfD;$LHD$(dH+%(H8HH5m[]A\A]A^A_SH5HSH5HSH5cHS|@H58HSd@H5 HySL@H5HaS4@HLME1t$LLZcXZHE1E11j1ҾL3cD$AYAZH5KHRT$HH51v|$ t"EH5HH1v|@T$H5H1v]FAWAVAUATIUHSHHcHI8%L-H5#H1E19vHLH5)H1H5SvHpH5?H1uAL$A9DLCPHH&HISH5¨HA1uEpDHnHH5CH1uHlppE1!DHA9#HHNH6pA9|I@H[]A\A]A^A_fH5CHH[]A\A]A^A_uH51DHIHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H=ǴHLH$$HD$HD$ D$0HD$]HT$dH+%(uHDfAVH tAUATIUS1H@dH%(HD$8H?HL$IH$H/HD$HD$H HD$ H#HD$(HHMt-LLLH, tHHHuHD$8dH+%(ugH@LH5`1[H=/]A\A]A^jf.HD$8dH+%(u)HL,H@L1[H5H=K/]A\A]A^'CfAVAUATUSHH5[ISL,IHuhH iE11LAH5bgtcLyctUL-)H=ֲH5`H1ur[L]A\A]A^fH E11L zfL(H=H5H1 rH=iLE19n[L]A\A]A^DE1[]LA\A]A^fH=)H5@E1qG[L]A\A]A^fH=5d+IHtD1LH5$H t$11H5L t MDLmH=LH5 1@qH=ff.@AVAUATUHHHH'HI,HI!{H5 MlLiIHt@LH5H^[LLLLH5LLHLHL]A\A]A^ÐH=H5-1E1XpHL]A\A]A^fH=H5,1E1(pfDʲATAUHS~21@H9~|tHQ9?H5-AH"(XaD EAWAVAUIATIUSH8L$L$t@)$)$)$)$)$)$)$)$ dH%(HD$x1H$p$ HD$H$D$0HD$9M XL|$ H=_LPLIH$=1!^L1ҾOL_H5L;HLHH_WH5H1~n11Ҿ HL\L ;HD$xdH+%(urH8[]A\A]A^A_qY.o$HT$ LIHD$LD$ HD$0VLH5d1mL F>fDAWALAVILAUI1ATMULSHHdH%(H$1lEIIAH { LHH0*HD11\=v,H$dH+%(H[]A\A]A^A_Ð=q6 LJHt$AMH *LE)11MH L11LL1H59rl~LLH1H11Ҿ L32/t;HHH9rL@L9tLǺ'^ILH[HATUSHHJHgH>H5ժHHTHH5.H9AHA t|L%q1E1L.H=.L . DHtCL9H9u&L9t!8uMtLH5vH=11[]A\ÐtRH5NJtBH5gL;Jt/H5L(JtH5LJA1Eu_E닐@EoD@@EODGE 0fD@ƀE DWH5.[ItwH5LHItdH5=LH=1LH5EHH-5L%X@HuHHHcEHtL1fEiH5G:HH5LHH59LHH5LmHH5#LVHt=H5LCHt*H5L0HtH5$LHH5LH=K1H5 HH-L% HuHHHcEHtL1fDoE(fD@ nEDEfD@NEDH=1:[1]A\HH51H=MH5HtH-L%(@HuHHtHcEHtL1fDHH51H=H5H`H-L%HuHH7HcEHtL1lf.HH561H=}HH5AHH-1L%THuHHHcEHtL1f.HH5Ƥ1H= H5їHH-L%HuHHWHcEHtL1f.HH5V1H=hH5aHH-QL%tHuHHHcEHtL1f.HH51H=-H5HH-L%HuHHwHcEHtL1f.HH5v1H=H5H0H-qL%HuHHHcEHtL1Ht2HDH{HHtL?u[]A\DH5H=a1HuHHtH1HHuHu[1]A\fAUATIUHSHdH%(HD$11HHD(Hn?H$:u=H9t8HHHv;"t I$DHutDH1D+HT$dH+%(u H[]A\A];.ff.AUATAHL-dH%(HD$1HL tH$HcAH9u!HD$dH+%(u+HDA\A]DLH5>H='@1P-fAUATIUHSHdH%(HD$11HHD(H)H$:u=H9t8HHHv;"t I$DHutDH1D+HT$dH+%(u H[]A\A],ff.AUATUHdH%(HD$1H$HO+OwHHHcH>AfHD$dH+%()HD]A\A]@HA@H=1 <ƅxHA HA}@xHA]@XHA=@8HA@HA?HA?HA?@HA?HA}?x HA]?XHA=?8 HA?HA>HA>HA>HA> HA}>xHA]>XHA=>8H5iHE1EAH5I1HE1L.AH5)1HE1|VAH= HAąH4$HA$+H=ј1 9ƅsHAHhH=HHHAzA5DH=i(DžE8H#HAąH1H5ڗH=K1H= 1RMIHHHAąL"HїH5z1H=wHH5Y1E1H=*hSHH551E1H=D/HhH51E1H= H5?H=8H5'H=x7H5H=7.'ff.AWAVAUATUSHH-tdH%(H$1HcRHH<HHDH|$Ht8-t0E1H$dH+%(SHD[]A\A]A^A_ÐS8-u x-x-Lx=LHS&HHHH L5M.ME'AhuEgEuH5L6tLLz6u~AF H tW-tRHPуFwJH J HcH>x9LxH9HeQH?EffDMnIMJHHRH HL=D`z&ctAw H2H4H=הHT$nIHAH5`H=tL-Ht$(ALHD$(HcЉD$H9!AV pNIH9H51H=LH51AH=OhpH-1Ht$(D HHnHT$(:H9H5Hu D#?H=Ht$ &A@H=iHt$0HPH51AH=fH=)Ht$(_DH-1Ht$(D HHHT$(:HpD#A5fHL$HT HH5D$H%=@-(;"땅IH[H51H=LH5H=41N"HM1AH5H=iLH51AH=HLH5{H=1;HH5AHc2HH Ht.9t)HttH<HL>Ht9u8HHtH5H=Y11Hf.H5ِH=Z11HHtH5H=V11HH5H=11afAWAVAUATUSHHL?dH%(HD$x1M IL-Lf.L9t+fA~ D`-tĴHLEdD9ALI~IHuø9NʼnD$HHD$I9E1DLsHI9ǸDDMH*LDL;|$&HI9HI9 fo@HD$ D$pHD$H)D$ )D$0)D$@)D$P)D$`I9EHH5HDL-V1LH-GH3HAǸDN>HHD1{ Aǃ-tzLH1NANjL$9ND9D)HD Ht$L1H=OL{HMHD$xdH+%(3HĈ[]A\A]A^A_D$L%!H=1L0L;HuI9LH=1 L;HHD$My{ A-H54H1D$p D$fov)D$ )D$0)D$@)D$P)D$`H=1H5[L1q@H=1ZDHcD$fDHLHD$Of.AUATUSHHtiHIHE+H5~hLH~RH:AąHt!XHٺHH5f HtxEuLAHD[]A\A]H5oH=Œ1E1hLH=1HT$dH+%(H[]A\ÐH$HPH=DL$$I|$H=HzH51|IH=ʼnPLHE1kfH$HxtH}H$HjHEHP*H$@@ H$'L$$I|$ t\H=%HH5H1H?HtLH$HEHшID$fHID$ |f.H=HBH5cFHL$$DH=HH5q1HL$$~ff.AWAVAUATIUHSHHdH%(HD$81HD$ JHuuH'H5LI1GMtLH5xL1G1HT$ H1AyMHD$8dH+%(^HH[]A\A]A^A_f.HHH56LH14GfLD$0HL$HHD$0HT$Ht$HD$(LL$(LD$(AI HD$0|H5J\?IHHHwHH fDHHBCBH9uGH|$( HL$LL T$H5LFH1AVDD$-:FXHZ HH5L1FH5LbDO<H\$0MOM9LϺ|H5LD$L $>L $LD$HIMK4>LH fHHBCBH9uDH|$ HtDH5L15EEHHHDfLvH=OLH1H5$DMH L1L$H5H=ߜL$H=ʜH 1H51fAVIAUATUHHS1T82fHsHILLHI ~3H9|LAąt]A[]DA\A]A^MH^LH=<LDH5q1LE1CH=[D]A\A]A^@H=H5H=y[D]A\A]A^ff.fAUAATUHS1H=IHLHH/H 9|EuH[]A\A]LH5qH[]A\A]ÐAWHIAVAUMATUSHHH L$Ld$X1HtHHxHHE1J11fDLHH.LX9|HjLH~D$`H$L  E1H|$Pt>hI1Mt/Ht$PL0tLkLXHH$L|$H[]A\A]A^A_f.Ht$IHHtkMLT$t!LHLT$E1>2tLT$MtLHE1r{H@H5H@E11GfDkIHtMtLH1H<$tH4$LH|$P1E1ff.UHH53H$/HH5H HH5] fATIUHHH=HHtSMtNLH5sHHHtp11Ҿt.HH5T&H1]A\D1H]A\fDH=IH5H=611Ҿ hfDH=LH5'1?룐AVAUIATIHUS6'HLHHEIWHtHH'u#L&[]A\A]A^f.LH5.L1 ?1L-vD=AtL5HML1LHLLH9|[]A\A]A^[L]LH5A\1A]A^>@ATIHUHHguH=D1H1ɾLHLH5rHHHDH1]A\>fDHLH5j1]A\=AWAVAH5AUAATE1UHSHdH%(HD$1=~AAEu]H5 H1E1= HA11E!HD$dH+%(XHD[]A\A]A^A_f!H5H1(=A!{H$IHto1HDr3unH<$E1E1H5H1E1At=%D9E1H%L)HD$XdH+%(H`D[]A\A]A^f IHD%EtE1Lt$OfH3HLHc/tQ@LLPt=vAM=S%D931HLuA@E1AA "fAUATUSHhdH%(HD$XHD%~HhH0EtyE1Ll$Y111Hb+t~~HAHHHc t^Ht$@LHtE~At=`~%D9HD$XdH+%(uHhD[]A\A]ACUHH=Q~H55~H=6~H2~HtHP(HH5#1]1HH51]n1ff.AWIAVAAUIATEUHSLH5|H=wq11Ҿ HLD$@HHH lt}H=5qHH510< <.!HHcHT: PIA9%Ex D9H[]A\A]A^A_H=pDH5_1P0{uVHuQH=pLL1H5&0 {u;H,mHH"fD1H[]A\A]A^A_ fMt=A}t6LD$HLHH (|fD{ H[]A\A]A^A_f.H=oDH51X/H=oH5"1;/1F@AWAVAUEATIULSHHxdH%(H$h1D$E~AFI҃HAAAA EIEI:L LDL$A1EtL$Mt+1H5H HH?I9uHBLH=vEAƄ$AA_AF LL+GHD$A3HD$@HD$HAH$H56LVH4$L|$nLt$pLHLLL<L-LL|HHD$ V|LHL|HD$,A|LHH[L|$ ML9zIHiHt$1HJJHT$LLr)2LLL\)?IHBHt$1HHD$0LD$0!HT$LL)LD$0LLL(LD$0L|$LLL(LD$0H$1LLD$8HHD$0;LD$8HD$L9SLd$@MIH\$0Hl$HHfDI)L9uHHLV(uLD$8Ld$@E1E1Hl$HL= AAAHZHLH5&HDCH‹$$uXtIHLH5H1"+H$hdH+%(Hx[]A\A]A^A_@$t t L@H5H1*HH5*LCHRfD Ht$`I}mHL$`1Ҁ9$)D$,ɚ;LiH=ɚ;L|$nH4$Lt$pLH8LLL-LdL|HHD$ hL|HXL|HHL$,P1L$HL&|LHL|HAhE1E1L=E1LL $|LtH<$L LL L11DH=iH51)f[HD$ HD$H|wH$DIx|LT$H5jD\$LD$H<$!H<$LD$HD\$LT$I>M L fDE1E1E1E1L=H=CЉT$,E1E1L=Ht$0LMLLHl$HLd$@$LD$8tHLD$8LL|$IHT$LH$ItAtHT$Ht$0LD$8IHt$01LLD$8LD$8XHt$1LLD$8LD$87HD$IHt[H\$8LItCHT$LH $uIE1L=E1LD$8IE1E1L=IH\$8H$ 1LLD$@HHD$8ALD$@H|$LD$@L=LLFLD$@HIHt$HD$H9H|$8LAL7Ht$8HzHHH IJJLHH)H)L$HH|$H)HH9rHt$8H1Ht$LLL$HLD$@LD$@LL$H3$H\$PLL|$@ILHHD$HHT$ LH"UHl$HuIHt$81Hl$XLH\$PLL|$@LD$@LD$@LL$XH|$ LLL$PLD$@LL$PHI H1Ht$8L$ Ll$8MHl$@HH\$XLHT$Ht$0H!oH1HHnH1HH+H|$PHT$LH!Ht$01HD$,HH9<Ht$1H#HHD$PFHT$LCL|$Ht$0LLD$8L#!LD$8MBHD$HH H5=dH=f|1D\$L$FLT$LL$D\$L$}1HD$LE1zHT$Ht$0HT$LH MHl$@Ll$8I>HT$ LHV zIILE1L|$@ILl$Ll$8LH\$XHl$@wLoH|$LLLHHH$$5j6$$H5_ $  1ɉ?<>@|HHu$$  $ 1ɉ?<>@|HHu$ $ $ 1ɉ?<>@| HHu$$ $  1ɉ?<>@| HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|!HHu$$ $ 1ɉ?<>@|%HHu$$ $ 1ɉ?<>@|)HHu$$ $ 1ɉ?<>@|-HHu$$ $ 1ɉ?<>@|1HHu$$ $ 1ɉ?<>@|5HHu$$ $ 1ɉ?<>@|9HHu$$ $ 1ɉ?<>@|=HHu$$ $ 1ɉ?<>@|AHHu$$ $ 1ɉ?<>@|EHHu$$ $ 1ɉ?<>@|IHHu$$ $ 1ɉ?<>@|MHHu$$ $  HL$H?<>@|QHHu$HH? HUHHWPV$$H5 $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@| HHu$$ $ 1ɉ?<>@| HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|HHu$$ $ 1ɉ?<>@|!HHu$$ $ 1ɉ?<>@|%HHu$HL$H?<>@|)HHuHH,HE1E1E1E1tff.AWIAVL5MAULATUSHH5HH=[dH%(H$1H HHl${CH=HcH>f.D$ L[L-yf.1HHL$ L$HALdI)1LH*LLS ~HII)NjD$ {HKH>HLL1 HcH=YLILH5LO1H(A$H HH$dH+%(.H[]A\A]A^A_D$ L7L-[DD$ L+MfD$ LMfD$ LϺL-DD$ LMyfD$ LMYfHLL1AIXfK1HLLfHII)Yff.@AWIHAVAUIATUHSH8dH%(H$(1D$cLd$ 2fLH5CH1H聾9\$L:HI轿HIM)AIcҹLLLT$HD$LD$1LLT$LIPBD 3[LH5H19\$cH$(dH+%(H8[]A\A]A^A_Ð11LLH$(dH+%(uAH5VH8H1[]A\A]A^A_{H$(dH+%(u H5ATIUHSH dH%(HD$1D$ HD$hH|$HH|$HHuMuOH|$t_1HtH|$ IE1111D$ HT$dH+%(u2H []A\HLHS1f.Ht!0>wH@@@@HAVIAUAATUSHHdH%(H$1HHH5LqIHt 1MMtrHHL1HeIHLQH)H$dH+%(HL[]A\A]A^EIHtMHHuH=TLH5 (LH=iTE1c@E1H=ITH51fH=)TLH5L8fDH=SH51vAVAUATUHHdH%(H$1裾=L5IH1L_LL1HL$LKdLLkLHy跫t HL|AExWH$dH+%(H]A\A]A^fH=RH5B1H=R_1H=RHL1H5]H=UTHL@H=RLH1H5ƴ%H=TfAWAVAUATIUSHHdH%(H$1=L$L1HHLL$L5LLL^H:1HLL]H'1HLHHHsHHIE~fLLHHHySH5ٳHHHUHD1H'@H=!QH5z1H= Q藷1H$dH+%(u_H[]A\A]A^A_LH=PL1H57pfDLH=PL1H5Hff.AWAVAUATUHSHdH%(H$1@=L$H1IL%HLL$H$LHL`L1LHL\H1H1L$L`H#LL1L[HHLHyt HLLLyQ謧tEt@H=)OLL1H5fH=P9LHNHLC^LH5AEH$dH+%(H[]A\A]A^A_H=NH51CH=N1H=yNHL1H5H= PHL@H=ANLH1H5~ H=OQH=NLH1H5N H=O!LL6ff.AWL=|NAVAUATUSHLH(Ht$LHT$ HL$ HH,HlH$IHt(I,LHH$Ht HH$/HIHHLAƅME1H5MDHJ4LD:Aƅt3II uH=LL1E1H5E1k fDAA E1wOH<$tIHH4$HAƅA AEA @AHD$AD(HD$E1L LHp )L豾H(D[]A\A]A^A_H<$H<$1"IHHD$E1L(AE1ApfH=K1E1E1H5~E gH=KH5f1E1( JH=iKH1E1H5 'H$H=EK1MH5C H=(KH5٭1E1 H= KH51E1 H=JH51E1 H$H=JH51o f.AWAVAUATUSHH(?/t$HT$BIHLsH5FKLHHC1ۄ+Ld$IIA$IAt<=uA$A>M|$ AFIVLHxIDžAIDLH|ÅxHLI茸L9u纷LHwH|$ H|$L۰H$HdH+%(HXD[]A\A]A^A_H=@H51E1AHD$L=@HD$ L$6D?ED$EH5v?H=w?肝IH;H.H|$XHaHHD$EHt$LH|$`H5w^H\$xH5iHB$E1HLHt$`P-Ht4L11H$HWtHc$H$Ht$LOH|$( LH2$n H$E11LHALHt$HH0CHt$HLF H|$@ H-=H $H HHHT$@LHH==Z $Ht$(L[ $uhH|$A蛠HHuX fDHDn謬H0DHdƅyLH3H L11H_H$8HHH|$XL== H=LnHH$(H/H$8?HD$PL$HxLAHHH=<H$8H51(H=q<H51HEHDDL5H|$ILHHHHoDLLE&AƅyAtqyH$L$LϖH$Ht H$L@H$H HtHHIWH=29H5[1eL$1E11H=9H5ӿL$IWL=9>HD$PLHxhHHtCH=8H$(H5B1SH=8H5e1>H$QH=h8H5i1 L2H$ H=C8H+H$H=%81H5?$ugH=8H5g1H=711ɾ CH4H$Ƅ$bH$LH1wfMtH5LT$XT$H5L1CIGM9uH5rL+葴AUIȉHATIUHHdH%(H$1IL;=wCH ML1tLH1H5.11Ҿ HAH$dH+%(u H]A\A]ܳff.AWAVAUATUSHH $HxL)L$H|$(LHt$0HT$ HL$LL$dH%(H$h1HHtHML1LH s$CL$`LLӱKX LȊHHtx t L譊HH=EHLHHD$LԉH1srMHL1Yr$$`POSTLVpMH L1rH LLA1H$~12LH 1Ҿi$E1H$hdH+%(;HxD[]A\A]A^A_Ð11ҾiH迃H׶HD$XH1HT$XkH|$XLه11H }LqH ިLL~H|$ t#L=H\$ LH;ژHLAʼnHD$H@$`GET L$dtE$`POST;L"fLH}LE1b^H芙H4DDH5LD$MHLL= AHyA9|Ļf.uH|LL]HHI HHL Hl|LH]H1Ht$LE1E1LyYH^MDHD$dH+%(*H([]A\A]A^A_w*HH LH{L ]H=H2HHHH5GLH HdLH5HLHgH wH+{LLp\H=9H5Z{1H裕H=HԅH= H59{1HgLHwHzLL[HL̎HHHHIHdHgzLH[H誌HLLt$E1E11LlLXZ@H=1H5:1HH=HDŽH=H5`1D1H=H5y1{ofDH=H5y1[fDH=H5y1;ofDH=yH5y1fDH=YH5Ky1HHt$1HxH|$N` &%HHapps/lib/cmp_mock_srv.capps/cmp.cmock server received error: pkiStatusInfo absent pkiStatusInfo: %s errorCode absent errorCode: %ld errorDetails absent errorDetails: profile1wrong certificate to revokekurp10crgenm%s: Use -help for summary. Unknown item name %s Supported types: %s Error reading PEM file asn1Can't find 'asn1' in '%s' '%s' is out of range Error parsing structure Can't parse %s type Error: offset out of range Error writing output Error parsing item %s apps/asn1parse.cunspecifiedCAkeyTimeholdInstructionapps/ca.cMemory allocation failure apps/lib/apps.crow exp_datarow ptrfailed to update database TXT_DB error number %ld ERROR:name does not match %s Revoking Certificate %s. Unknown CRL reason %s Invalid object identifier %s revocation reasonrfc_822iso_8601No configuration used Using configuration from %s default_caoid_filestring_maskutf8yesunique_subjectdatabaserow serial#Serial %s not present in db. %s=Valid (%c) %s=Revoked (%c) %s=Expired (%c) %s=Suspended (%c) %s=Unknown (%c). Error verifying serial %s! private_keyError getting password CA certificatepreservemsie_hackname_optInvalid name options: "%s" cert_optcopy_extensionsnew_certs_dir%s: %s is not a directory in entry %d generating index Updating %s ... %s=Expired Malloc failure UNDEFdefault_mdno default digest email_in_dnnomessage digest is %s policy is %s rand_serialx509_extensionsdefault_startdatedefault_enddatedefault_daysnext serial number is 00 next serial number is %s error on line %ld of %s Signature ok template certificateerror unpacking public key CERTIFICATION CANCELED writing new certificates writing %s Database updated crl_extensionscrlnumberdefault_crl_daysdefault_crl_hoursmaking CRL signing CRL no input files certificate to be revokederror setting CRL nextUpdate error setting CRL lastUpdate UNKNOWNOpenSSL cipher name: %s Error in cipher list 0x%02X,0x%02X - %-45s - %s:%s:%d:CMP %s: %s %s%s actually sendingactually usingint:str:trusted TLS certsextra certificates for TLSTLS client private keycertificate to be updatedhttp%s://%s:%s/%s via %suntrusted certificatescerts trusted by clientPBMACextra certificates for CMPPKCS#10 CSRSubject Alternative Namerecipientexpected senderdeletingwriting%s certificateverbosity-%sDisplay this summaryGeneric message options: cmdinfotypeprofilegeninfotemplatekeyspecnewkeynewkeypasscentralkeygennewkeyoutreqextssanssan_nodefaultpoliciespolicy_oidspolicy_oids_criticalpopocsrout_trustedimplicit_confirmdisable_confirmchainoutoldcertrevreasonMessage transfer options: no_proxykeep_alivemsg_timeouttotal_timeoutunless -srvcert is givensrvcertexpect_senderignore_keyusageunprotected_errorsno_cache_extracertssrvcertoutextracertsoutcacertsoutoldwitholdcrlcertoldcrlcrloutown_trustedunprotected_requestsCredentials format options: crlformotherpassProvider options: provider-pathproviderprovparampropqueryRandom state options: writerandTLS connection options: tls_usedtls_certtls_keytls_keypasstls_extratls_trustedtls_hostbatchrepeatreqinreqin_new_tidreqoutreqout_onlyrspinrspoutuse_mock_srvMock server options: max_msgssrv_refsrv_secretsrv_certCertificate of the serversrv_keysrv_keypasssrv_trustedsrv_untrustedref_certrsp_certrsp_keyrsp_keypassrsp_crlrsp_extracertsrsp_capubsrsp_newwithnewrsp_newwitholdrsp_oldwithnewpoll_countcheck_aftergrant_implicitconfpkistatusfailurebitsstatusstringsend_errorsend_unprotectedsend_unprot_erraccept_unprotectedaccept_unprot_erraccept_raverifiedValidation options: certificate chain purposeverify_nameverification policy nameverify_depthchain depth limitauth_levelattimeverification epoch timeverify_hostnameexpected peer hostnameverify_emailexpected peer emailverify_ipexpected peer IP addressignore_criticalissuer_checks(deprecated)crl_checkcrl_check_allcheck full chain revocationpolicy_checkperform rfc5280 policy checksexplicit_policyinhibit_anyinhibit_mapx509_strictextended_crlenable extended CRL featuresuse_deltasuse delta CRLspolicy_printcheck_ss_sigcheck root CA self-signaturestrusted_firstsuiteB_128_onlySuite B 128-bit-only modesuiteB_128suiteB_192Suite B 192-bit-only modepartial_chainno_alt_chainsno_check_timeallow_proxy_certsUsage: %s [options] [cipher] General options: Even more verbosestdnameShow standard cipher namesconvertOnly supported ciphersCiphers compatible with TLS1pskciphersuiteskeyCompromiseCACompromiseaffiliationChangedsupersededcessationOfOperationcertificateHoldremoveFromCRLcompatibleca_defaultno_headerno_versionno_serialno_signameno_validityno_subjectno_issuerno_pubkeyno_extensionsno_sigdumpno_auxno_attributesext_defaultext_errorext_parseext_dumpoutdirWhere to put output certThe input cert request(s)informinfilesdateoptnotextDon't ask questionsss_certspkacConfiguration options: A config fileAn alias for -nameThe CA 'policy' to supportCertificate options: subjcreate_serialmultivalue-rdnnot_beforeAn alias for -startdatenot_afterAn alias for -enddateextfilepreserveDNDon't re-order the DNnoemailDNThe CA private keyThe CA certselfsignvfyoptRevocation options: gencrlGenerate a new CRLupdatedbUpdates db for expired certcrlextscrl_reasoncrl_holdcrl_compromisecrl_CA_compromisecrl_lastupdatecrl_nextupdatecrldayscrlhourscrlsecRevoke a cert (given in file)certreqoidfile of extra oid definitionsI/O options: nooutdo not produce any outputoffsetoffset into filelength of section in filestrparsegenstrgenconfstrictpemitemitem to parse and print(-inform will be ignored)Formatting options: indents the outputunknown data in hex formdlimit%s:%s:%d:CMP %s: %s option argument is empty string, resetting option%s%s %s:%s:%d:CMP %s: %s option argument starts with hyphen%s%s %s:%s:%d:CMP %s: unknown cmp command '%s'%s%s %s:%s:%d:CMP %s: no cmp command to execute%s%s%s %s:%s:%d:CMP %s: unknown option given for key loading format%s%s%s %s:%s:%d:CMP %s: unknown option given for certificate storing format%s%s%s %s:%s:%d:CMP %s: unknown option given for CRL storing format%s%s%s variable lookup failed for %s::%s %s: Memory allocation failure Adding Entry with serial number %s to DB for %s %s: Could not allocate %zu bytes for %s ERROR:Already present, serial number %s ERROR:Already revoked, serial number %s Invalid time format %s. Need YYYYMMDDHHMMSSZ Error in revocation arguments Invalid global string mask setting %s Problem with index file: %s (could not load/parse file) CA certificate and CA private key do not match Invalid certificate options: "%s" Invalid extension copy option: "%s" there needs to be defined a directory for new certificate to be placed in entry %d: not revoked yet, but has a revocation date entry %d: invalid expiry date entry %d: bad serial number length (%d) entry %d: bad char 0%o '%c' in serial number %d entries loaded from the database No entries found to mark expired Done. %d entries marked as expired Successfully loaded extensions file %s Error checking certificate extensions from extfile section %s Error checking certificate extension config section %s cannot lookup how many days to certify for Warning: -enddate or -not_after option overriding -days option error generating serial number error while loading serial number unable to find 'section' for %s no name/value pairs found in %s unable to load Netscape SPKAC structure Netscape SPKAC structure not found in %s Check that the SPKAC request matches the signature error unpacking SPKAC public key signature verification failed on SPKAC public key Check that the request matches the signature Signature verification problems.... Signature did not match the certificate %d out of %d certificate requests certified, commit? [y/n]CERTIFICATION CANCELED: I/O error Write out database with %d new entries certificate file name too long Error checking CRL extension section %s error while loading CRL number cannot lookup how long until the next CRL is issued Error adding CRL extensions from section %s Error setting TLSv1.3 ciphersuites 0x%02X,0x%02X,0x%02X,0x%02X - %s:%s:%d:CMP %s: NULL arg to write_PKIMESSAGE%s%s%s %s:%s:%d:CMP %s: not enough file names provided for writing PKIMessage%s%s%s %s:%s:%d:CMP %s: cannot write PKIMessage to file '%s'%s%s %s:%s:%d:CMP %s: not enough file names provided for reading PKIMessage%s%s%s %s:%s:%d:CMP %s: cannot read PKIMessage from file '%s'%s%s %s:%s:%d:CMP %s: cannot write request PKIMessage to file '%s'%s%s %s:%s:%d:CMP %s: too few -rspin filename arguments; resorting to using mock server%s%s%s %s:%s:%d:CMP %s: missing -server or -use_mock_srv option, or too few -rspin filename arguments%s%s%s %s:%s:%d:CMP %s: too few -rspin filename arguments; resorting to contacting server%s%s%s %s:%s:%d:CMP %s: failed to load ir/cr/kur file '%s' attempting to get fallback public key%s%s %s:%s:%d:CMP %s: failed to get fallback public key from ir/cr/kur file '%s'%s%s %s:%s:%d:CMP %s: failed to get fallback public key obtained from ir/cr/kur file '%s'%s%s %s:%s:%d:CMP %s: Missing ':' in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Invalid OID in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Unknown OID in -geninfo arg: %.40s%s%s %s:%s:%d:CMP %s: Cannot parse int in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Missing ',' or end of -geninfo arg after int at %.40s%s%s %s:%s:%d:CMP %s: Missing 'int:' or 'str:' in -geninfo arg %.40s%s%s %s:%s:%d:CMP %s: Unable to create 'OSSL_CMP_ITAV' structure%s%s%s %s:%s:%d:CMP %s: Failed to add ITAV for geninfo of the PKI message header%s%s%s %s:%s:%d:CMP %s: out of memory%s%s%s error setting verification parameters for %s %s:%s:%d:CMP %s: -tls_used given without -tls_trusted; will not authenticate the TLS server%s%s%s TLS client certificate (optionally with chain)%s:%s:%d:CMP %s: unable to use client TLS certificate file '%s'%s%s %s:%s:%d:CMP %s: could not add untrusted cert to TLS client cert chain%s%s%s %s:%s:%d:CMP %s: trying to build cert chain for own TLS cert%s%s%s %s:%s:%d:CMP %s: success building cert chain for own TLS cert%s%s%s %s:%s:%d:CMP %s: could not build cert chain for own TLS cert%s%s%s error: unable to add TLS extra certs %s:%s:%d:CMP %s: TLS private key '%s' does not match the TLS certificate '%s' %s %s:%s:%d:CMP %s: unable to use TLS client private key '%s'%s%s %s:%s:%d:CMP %s: -tls_used given without -tls_key; cannot authenticate to the TLS server%s%s%s , and -key option superseded by -csrfallback public key for cert to be enrolledpublic key for checking cert resulting from p10crreference certificate (oldcert) only if -rspin argument gives too few filenames%s:%s:%d:CMP %s: missing -server or -use_mock_srv or -rspin option%s%s%s %s:%s:%d:CMP %s: ignoring -proxy option since -server is not given%s%s%s %s:%s:%d:CMP %s: ignoring -no_proxy option since -server is not given%s%s%s %s:%s:%d:CMP %s: cannot parse -server URL: %s%s%s %s:%s:%d:CMP %s: assuming -tls_used since -server URL indicates HTTPS%s%s%s %s:%s:%d:CMP %s: no -infotype option given for genm%s%s%s %s:%s:%d:CMP %s: -infotype option is ignored for commands other than 'genm'%s%s%s %s:%s:%d:CMP %s: unknown OID name in -infotype option%s%s%s %s:%s:%d:CMP %s: -oldwithold %s%s%s option is ignored unless -cmd 'genm' and -infotype rootCaCert is given%s:%s:%d:CMP %s: -newwithnew %s%s%s %s:%s:%d:CMP %s: -newwithold %s%s%s %s:%s:%d:CMP %s: -oldwithnew %s%s%s %s:%s:%d:CMP %s: -template %s%s%s option is ignored unless -cmd 'genm' and -infotype 'certReqTemplate' is given%s:%s:%d:CMP %s: -keyspec %s%s%s %s:%s:%d:CMP %s: missing -template option for genm with infotype certReqTemplate%s%s%s %s:%s:%d:CMP %s: -trusted option is ignored since -srvcert option is present%s%s%s %s:%s:%d:CMP %s: -recipient option is ignored since -srvcert option is present%s%s%s directly trusted CMP server certificatetrusted certs for verifying newly enrolled cert%s:%s:%d:CMP %s: -total_timeout argument = %d must not be < %d (-msg_timeout)%s %s:%s:%d:CMP %s: -reqin is ignored since -rspin is present%s%s%s %s:%s:%d:CMP %s: -reqin_new_tid is ignored since -reqin is not present%s%s%s %s:%s:%d:CMP %s: missing -tls_key option%s%s%s %s:%s:%d:CMP %s: missing -tls_cert option%s%s%s %s:%s:%d:CMP %s: must give -key or -secret unless -unprotected_requests is used%s%s%s %s:%s:%d:CMP %s: must give -ref if no -cert and no -subject given%s%s%s %s:%s:%d:CMP %s: must give both -cert and -key options or neither%s%s%s %s:%s:%d:CMP %s: -cert and -key not used for protection since -secret is given%s%s%s private key for CMP client certificate%s:%s:%d:CMP %s: will not authenticate server due to missing -secret, -trusted, or -srvcert%s%s%s CMP client certificate (optionally with chain)trusted certs for verifying own CMP signer cert%s:%s:%d:CMP %s: -own_trusted option is ignored without -cert%s%s%s %s:%s:%d:CMP %s: digest algorithm name not recognized: '%s'%s%s %s:%s:%d:CMP %s: digest algorithm name not supported: '%s'%s%s %s:%s:%d:CMP %s: MAC algorithm name not recognized: '%s'%s%s %s:%s:%d:CMP %s: no -subject given; no -csr or -oldcert or -cert available for fallback%s%s%s %s:%s:%d:CMP %s: missing -newkey (or -key) to be certified and no -csr, -oldcert, -cert, or -reqin option given, which could provide fallback public key. Neither central key generation is requested.%s%s%s %s:%s:%d:CMP %s: POPO is disabled, which implies -centralkeygen%s%s%s %s:%s:%d:CMP %s: -popo value %d is inconsistent with -centralkeygen%s%s %s:%s:%d:CMP %s: -newkeyout not given, nowhere to save centrally generated key%s%s%s %s:%s:%d:CMP %s: no -newkey option given with private key for POPO, -csr option provides just public key%s%s%s %s:%s:%d:CMP %s: since -reqin is used, may use -popo -1 or -popo 0 to disable the needless generation of a POPO%s%s%s %s:%s:%d:CMP %s: missing -newkey (or -key) option for key to be certified and for POPO%s%s%s %s:%s:%d:CMP %s: -certout not given, nowhere to save newly enrolled certificate%s%s%s %s:%s:%d:CMP %s: -subject %s since sender is taken from -ref or -cert%s%s option is ignored for commands other than 'ir', 'cr', and 'kur'%s:%s:%d:CMP %s: -issuer %s and 'rr'%s%s %s:%s:%d:CMP %s: -reqexts %s%s%s %s:%s:%d:CMP %s: -san_nodefault %s%s%s %s:%s:%d:CMP %s: -sans %s%s%s %s:%s:%d:CMP %s: -policies %s%s%s %s:%s:%d:CMP %s: -policy_oids %s%s%s %s:%s:%d:CMP %s: -popo %s%s%s %s:%s:%d:CMP %s: -popo -1 or -centralkeygen %s%s%s %s:%s:%d:CMP %s: -newkeyout %s%s%s %s:%s:%d:CMP %s: -implicit_confirm %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: -disable_confirm %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: -certout %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: -chainout %s, and 'p10cr'%s%s %s:%s:%d:CMP %s: missing -oldcert for certificate to be updated and no -csr given%s%s%s %s:%s:%d:CMP %s: given -subject '%s' overrides the subject of '%s' for KUR%s %s:%s:%d:CMP %s: missing -oldcert or -issuer and -serial for certificate to be revoked and no -csr given%s%s%s %s:%s:%d:CMP %s: ignoring -csr since certificate to be revoked is given%s%s%s %s:%s:%d:CMP %s: Must give both -issuer and -serial options or neither%s%s%s %s:%s:%d:CMP %s: Ignoring -oldcert since -issuer and -serial is given for command 'rr'%s%s%s %s:%s:%d:CMP %s: Ignoring -csr since -issuer and -serial is given for command 'rr'%s%s%s %s:%s:%d:CMP %s: cannot read serial number: '%s'%s%s %s:%s:%d:CMP %s: Ignoring -serial for command other than 'rr'%s%s%s %s:%s:%d:CMP %s: missing PKCS#10 CSR for p10cr%s%s%s %s:%s:%d:CMP %s: missing -recipient, -srvcert, -issuer, -oldcert or -cert; recipient for any requests not covered by -reqin will be set to "NULL-DN"%s%s%s %s:%s:%d:CMP %s: -newkeypass %s%s%s option is ignored for 'p10cr', 'rr', and 'genm' commands%s:%s:%d:CMP %s: -newkey %s%s%s %s:%s:%d:CMP %s: -days %s%s%s %s:%s:%d:CMP %s: -out_trusted %s%s%s new private key for cert to be enrolled%s:%s:%d:CMP %s: could not set requested cert validity period%s%s%s %s:%s:%d:CMP %s: cannot have policies both via -policies and via -policy_oids%s%s%s %s:%s:%d:CMP %s: -csr option is ignored for 'genm' command%s%s%s %s:%s:%d:CMP %s: cannot load certificate request extension section '%s'%s%s %s:%s:%d:CMP %s: cannot load policy cert request extension section '%s'%s%s %s:%s:%d:CMP %s: cannot have Subject Alternative Names both via -reqexts and via -sans%s%s%s %s:%s:%d:CMP %s: bad syntax of %s '%s'%s %s:%s:%d:CMP %s: -opt_san_nodefault has no effect when -sans is used%s%s%s %s:%s:%d:CMP %s: -opt_policy_oids_critical has no effect unless -policy_oids is given%s%s%s %s:%s:%d:CMP %s: Invalid -policy_oids arg '%s'%s%s %s:%s:%d:CMP %s: Unknown -policy_oids arg: %.40s%s%s %s:%s:%d:CMP %s: cannot add policy with OID '%s'%s%s %s:%s:%d:CMP %s: -oldcert option is ignored for 'genm' command%s%s%s %s:%s:%d:CMP %s: will contact %s%s%s %s:%s:%d:CMP %s: received %d %s certificate(s), saving to file '%s' %s:%s:%d:CMP %s: saving more than one certificate in non-PEM format%s%s%s %s:%s:%d:CMP %s: could not open file '%s' for %s %s certificate(s) error: unsupported type '%s' for writing certificates %s:%s:%d:CMP %s: cannot write %s certificate to file '%s'%s %s:%s:%d:CMP %s: Failed to delete %s, which should be done to indicate there is no %s%s %s:%s:%d:CMP %s: genp does not contain any ITAV%s%s%s %s:%s:%d:CMP %s: could not get ITAV #%d from genp%s%s %s:%s:%d:CMP %s: error parsing type of ITAV #%d from genp%s%s %s:%s:%d:CMP %s: ITAV #%d from genp infoType=%s%s assertion failed: OSSL_NELEM(cmp_vars) == n_options + OPT_PROV__FIRST + 1 - OPT_PROV__LAST + OPT_R__FIRST + 1 - OPT_R__LAST + OPT_V__FIRST + 1 - OPT_V__LASTNon-positive number "%ld" for config option -%s Negative number "%ld" for config option -%s %s:%s:%d:CMP %s: internal: unsupported type '%c' for option '%s'%s %s:%s:%d:CMP %s: for option '%s' in config file section '%s'%s integer value out of range for option '%s' %s:%s:%d:CMP %s: Logging verbosity level %d out of range (0 .. 8)%s%s %s:%s:%d:CMP %s: -keep_alive argument must be 0, 1, or 2%s%s%s %s:%s:%d:CMP %s: invalid popo spec. Valid values are -1 .. 2%s%s%s %s:%s:%d:CMP %s: invalid revreason. Valid values are -1 .. 6, 8 .. 10%s%s%s Configuration file to use. "" = none. Default from env variable OPENSSL_CONFSection(s) in config file to get options from. "" = 'default'. Default 'cmp'Log level; 3=ERR, 4=WARN, 6=INFO, 7=DEBUG, 8=TRACE. Default 6 = INFOCMP request to send: ir/cr/kur/p10cr/rr/genmInfoType name for requesting specific info in genm, with specific supportfor 'caCerts' and 'rootCaCert'Certificate profile name to place in generalInfo field of request PKIHeaderComma-separated list of OID and value to place in generalInfo PKIHeaderof form :int: or :str:, e.g. '1.2.3.4:int:56789, id-kp:str:name'File to save certTemplate received in genp of type certReqTemplateOptional file to save Key specification received in genp of type certReqTemplateCertificate enrollment options: Private or public key for the requested cert. Default: CSR key or client keyNew private key pass phrase sourceRequest central (server-side) key generation. Default is local generationFile to save centrally generated key, in PEM formatDistinguished Name (DN) of subject to use in the requested cert templateFor kur, default is subject of -csr arg or reference cert (see -oldcert)this default is used for ir and cr only if no Subject Alt Names are setRequested validity time of the new certificate in number of daysName of config file section defining certificate request extensions.Augments or replaces any extensions contained CSR given with -csrSubject Alt Names (IPADDR/DNS/URI) to add as (critical) cert req extensionDo not take default SANs from reference certificate (see -oldcert)Name of config file section defining policies certificate request extensionPolicy OID(s) to add as policies certificate request extensionFlag the policy OID(s) given with -policy_oids as criticalProof-of-Possession (POPO) method to use for ir/cr/kur where-1 = NONE, 0 = RAVERIFIED, 1 = SIGNATURE (default), 2 = KEYENCPKCS#10 CSR file in PEM or DER format to convert or to use in p10crCertificates to trust when verifying newly enrolled certificatesRequest implicit confirmation of newly enrolled certificatesDo not confirm newly enrolled certificate w/o requesting implicitconfirmation. WARNING: This leads to behavior violating RFC 9810File to save newly enrolled certificateFile to save the chain of newly enrolled certificateCertificate enrollment and revocation options: Certificate to be updated (defaulting to -cert) or to be revoked in rr;also used as reference (defaulting to -cert) for subject DN and SANs.Issuer is used as recipient unless -recipient, -srvcert, or -issuer givenDN of the issuer to place in the certificate template of ir/cr/kur/rr;also used as recipient if neither -recipient nor -srvcert are givenSerial number of certificate to be revoked in revocation request (rr)Reason code to include in revocation request (rr); possible values:0..6, 8..10 (see RFC5280, 5.3.1) or -1. Default -1 = none included[http[s]://]address[:port][/path] of CMP server. Default port 80 or 443.address may be a DNS name or an IP address; path can be overridden by -path[http[s]://]address[:port][/path] of HTTP(S) proxy to use; path is ignoredList of addresses of servers not to use HTTP(S) proxy forDefault from environment variable 'no_proxy', else 'NO_PROXY', else noneDN of CA. Default: subject of -srvcert, -issuer, issuer of -oldcert or -certHTTP path (aka CMP alias) at the CMP server. Default from -server, else "/"Persistent HTTP connections. 0: no, 1 (the default): request, 2: requireNumber of seconds allowed per CMP message round trip, or 0 for infiniteOverall time an enrollment incl. polling may take. Default 0 = infiniteServer authentication options: Certificates to use as trust anchors when verifying signed CMP responsesIntermediate CA certs for chain construction for CMP/TLS/enrolled certsServer cert to pin and trust directly when verifying signed CMP responsesDN of expected sender of responses. Defaults to subject of -srvcert, if anyIgnore CMP signer cert key usage, else 'digitalSignature' must be allowedAccept missing or invalid protection of regular error messages and negativecertificate responses (ip/cp/kup), revocation responses (rp), and PKIConfWARNING: This setting leads to behavior allowing violation of RFC 9810Do not keep certificates received in the extraCerts CMP message fieldFile to save the server cert used and validated for CMP response protectionFile to save extra certificates received in the extraCerts fieldFile to save CA certs received in caPubs field or genp with id-it-caCertsRoot CA certificate to request update for in genm of type rootCaCertFile to save NewWithNew cert received in genp of type rootCaKeyUpdateFile to save NewWithOld cert received in genp of type rootCaKeyUpdateFile to save OldWithNew cert received in genp of type rootCaKeyUpdatecertificate to request a CRL for in genm of type crlStatusListCRL to request update for in genm of type crlStatusListFile to save new CRL received in genp of type 'crls'Client authentication options: Reference value to use as senderKID in case no -cert is givenPrefer PBM (over signatures) for protecting msgs with given password sourceClient's CMP signer certificate; its public key must match the -key argumentThis also used as default reference for subject DN and SANs.Any further certs included are appended to the untrusted certsOptional certs to verify chain building for own CMP signer certCMP signer private key, not used when -secret givenClient private key (and cert and old cert) pass phrase sourceDigest to use in message protection and POPO signatures. Default "sha256"MAC algorithm to use in PBM-based message protection. Default "hmac-sha1"Certificates to append in extraCerts field of outgoing messages.This can be used as the default CMP signer cert chain to includeSend request messages without CMP-level protectionFormat (PEM or DER) to use when saving a certificate to a file. Default PEMFormat (PEM or DER) to use when saving a CRL to a file. Default DERFormat of the key input (ENGINE, other values ignored)Pass phrase source potentially needed for loading certificates of othersUse crypto engine with given identifier, possibly a hardware device.Engines may also be defined in OpenSSL config file engine section.Provider load path (must be before 'provider' argument if required)Provider to load (can be specified multiple times)Set a provider key-value parameterProperty query used when fetching algorithmsLoad the given file(s) into the random number generatorWrite random data to the specified fileEnable using TLS (also when other TLS options are not set)Client's TLS certificate. May include chain to be provided to TLS serverPrivate key for the client's TLS certificatePass phrase source for the client's private TLS key (and TLS cert)Extra certificates to provide to TLS server during TLS handshakeTrusted certificates to use for verifying the TLS server certificate;this implies hostname validationAddress to be checked (rather than -server) during TLS hostname validationClient-side debugging options: Do not interactively prompt for input when a password is required etc.Invoke the transaction the given positive number of times. Default 1Take sequence of CMP requests to send to server from file(s)Use fresh transactionID for CMP requests read from -reqinSave sequence of CMP requests created by the client to file(s)Save first CMP request created by the client to file and exitProcess sequence of CMP responses provided in file(s), skipping serverSave sequence of actually used CMP responses to file(s)Use internal mock server at API level, bypassing socket-based HTTPAct as HTTP-based mock server listening on given portmax number of messages handled by HTTP mock server. Default: 0 = unlimitedReference value to use as senderKID of server in case no -srv_cert is givenPassword source for server authentication with a pre-shared key (secret)Private key used by the server for signing messagesServer private key (and cert) pass phrase sourceTrusted certificates for client authenticationIntermediate certs that may be useful for verifying CMP protectionCertificate to be expected for rr and any oldCertID in kur messagesCertificate to be returned as mock enrollment resultPrivate key for the certificate to be returned as mock enrollment resultKey to be returned for central key pair generationResponse private key (and cert) pass phrase sourceCRL to be returned in genp of type crlsExtra certificates to be included in mock certification responsesCA certificates to be included in mock ip responseNew root CA certificate to include in genp of type rootCaKeyUpdateNewWithOld transition cert to include in genp of type rootCaKeyUpdateOldWithNew transition cert to include in genp of type rootCaKeyUpdateNumber of times the client must poll before receiving a certificateThe check_after value (time to wait) to include in poll responseGrant implicit confirmation of newly enrolled certificatePKIStatus to be included in server response. Possible values: 0..6A single failure info bit number to include in server response, 0..26Number representing failure bits to include in server response, 0..2^27 - 1Status string to be included in server responseForce server to reply with error messageSend response messages without CMP-level protectionIn case of negative responses, server shall send unprotected error messages,certificate responses (ip/cp/kup), and revocation responses (rp).WARNING: This setting leads to behavior violating RFC 9810Accept missing or invalid protection of requestsAccept unprotected error messages from clientAccept RAVERIFIED as proof-of-possession (POPO)adds policy to the acceptable policy setchain authentication security levelpermit unhandled critical extensionscheck leaf certificate revocationset policy variable require-explicit-policyset policy variable inhibit-any-policyset policy variable inhibit-policy-mappingdisable certificate compatibility work-aroundsprint policy processing diagnosticssearch trust store first (default)Suite B 128-bit mode allowing 192-bit algorithmsaccept chains anchored by intermediate trust-store CAsignore certificate validity timeallow the use of proxy certificatesVerbose listing of the SSL/TLS ciphersConvert standard name into OpenSSL nameCipher specification options: Ciphers compatible with TLS1.1Ciphers compatible with TLS1.2Ciphers compatible with TLS1.3Include ciphersuites requiring PSK(deprecated) Include ciphersuites requiring SRPConfigure the TLSv1.3 ciphersuites to useCipher string to decode (optional)Usage: %s [options] [certreq...] Verbose output during processingTerse output during processingCSR input format to use (PEM or DER; by default try PEM first)The last argument, requests to processWhere to put the output file(s)Datetime format used for printing. (rfc_822/iso_8601). Default is rfc_822.Do not print the generated certificatemsie modifications to handle all Universal StringsFile contains a self signed cert to signFile contains DN and signed public key and challengeUse engine, possibly a hardware deviceThe particular CA definition to useUse arg instead of request's subjectInput characters are UTF8; default ASCIIIf reading serial fails, create a new random serialAlways create a random serial; do not store itDeprecated; multi-valued RDNs support is always on.[CC]YYMMDDHHMMSSZ value for notBefore certificate field[CC]YYMMDDHHMMSSZ value for notAfter certificate field, overrides -daysNumber of days from today to certify the cert forExtension section (override value in config file)Configuration file with X509v3 extensions to addDon't add the EMAIL field to the DNDigest to use, such as sha256; see openssl help for listPrivate key file format (ENGINE, other values ignored)Key and cert input file pass phrase sourceKey to decrypt the private key or cert files if encrypted. Better use -passinCertificate input format (DER/PEM/P12); has no effectSign a cert with the key associated with itSignature parameter in n:v formVerification parameter in n:v formAdd a Valid(not-revoked) DB entry about a cert (given in file)Shows cert status given the serial numberCRL extension section (override value in config file)the hold instruction, an OID. Sets revocation reason to certificateHoldsets compromise time to val and the revocation reason to keyCompromisesets compromise time to val and the revocation reason to CACompromiseSets the CRL lastUpdate time to val (YYMMDDHHMMSSZ or YYYYMMDDHHMMSSZ)Sets the CRL nextUpdate time to val (YYMMDDHHMMSSZ or YYYYMMDDHHMMSSZ)Days until the next CRL is dueHours until the next CRL is dueSeconds until the next CRL is dueCertificate requests to be signed (optional)input format - one of DER PEM B64output file (output format is always DER)offset; a series of these can be used to 'dig'into multiple ASN1 blob wrappingsstring to generate ASN1 structure fromfile to generate ASN1 structure fromequivalent to '-inform pem' (obsolete)dump the first arg bytes of unknown data in hex formp`0`pbP`XbHbb0a8bbcccpcXc@c0cbxv}||||||p|vwwx`HЀXwh0~~~x~h~X~H~0~~}}}wwyX}}x}P|8| ||{{H}y\dtdT ̵ܵ,D!,t\L4dL<$ t\L4 | d L 4  t\D, lT<$ |t\DPP Q @ /  """""""p"_"P"?"/"" "!!!!!!!!t!c!R!A!0!!! q b 8888-P-Hset_verbosityget_optsopt_strread_config-M-Sprint_itavsdelete_filesave_free_certssetup_verification_ctxsetup_protection_ctxset_gennamessetup_request_ctxsetup_client_ctxhandle_opt_geninfoset_fallback_pubkeysetup_ssl_ctxtransform_optsread_write_req_respread_PKIMESSAGEwrite_PKIMESSAGE0123456789ABCDEFprocess_pollReqprocess_certConfprocess_errorcheck_client_crlprocess_genmprocess_rrprocess_cert_requestclean_transactiondelayed_deliveryossl_cmp_mock_srv_set1_newWithOldossl_cmp_mock_srv_set1_newWithNewossl_cmp_mock_srv_set1_caPubsOutossl_cmp_mock_srv_set1_chainOutossl_cmp_mock_srv_set1_certOutossl_cmp_mock_srv_set1_refCertmock serverpkix/Not FoundInternal Server Errorapplication/pkixcmp%s:%s:%d:CMP %s: No %s%s%s Key %s: Key algorithm: Key algorithm: RSA %d Invalid key spec: %s End of key %s%s:%s:%d:CMP %s: %.*s%s Bad input format for %s rbCAdESCMSInvalid key %s Invalid id %s Invalid OID %s recipient certificate fileNo key specified key param bufferapps/cms.cNo secret key id originator certificate fileSMIMECan't read content file %s Error writing certs to %s Can't open receipt file %s signer certificateError creating CMS structure %s Verification successful %s Verification failure Error writing signers to %s Signer %d: No Receipt Request Signed Content ID: Receipts From List: : First Tier : All Unknown (%d) Receipts To: To: %s%sFrom: %s%sSubject: %s%sError writing CMS output Missing CRL signing key other CRLCRL signing keyError creating delta CRL issuer=crlNumber=0xissuer name hash=%08lx issuer name old hash=lastUpdate=nextUpdate=NONE%s Fingerprint=%02X%cunable to write CRL unable to load CRL error opening the file, %s error reading the file, %s error loading certificates unable to write pkcs7 object RSA-%-25s\ *%s apps/dgst.c%s(%s)= Read error in %s Verified OK Error verifying data Signature bufferError signing data Digest bufferError Digesting Data etaonrishdlcupfmSHA256I/O bufferSupported digests: MAC parameter error "%s" Error getting context Error setting context Error setting digest signature bufferDHXsafe type-specificSubjectPublicKeyInfoMSBLOBError getting passwords unable to load Key Not a DSA key Public Key=writing DSA key %s format not supported encrypt-levelinvalid PVK encryption level unable to write key apps/dsa.cread DSA key This could take some time DSA parameters from PBMAC secret of mock servercerts trusted by mock servercaPubs for mock serverNewWithNew cert from genpNewWithOld cert from genpOldWithNew cert from genpCRL from genp of type 'crls'certTemplate from genpkeySpec from genpwbPKIStatusInfo bufvalidated servernewly enrolled cert and chainnewly enrolledAES-256-CBCInput options: Input fileInput format - DER or PEMOutput fileoutformOutput format - DER or PEMPrint as textNo outputVerbose outputTerse outputgenkeyGenerate a DSA keynumbitsnumqbitsAny supported cipherpvk-strongpvk-weakpvk-noneDon't enforce PVK encodingInput keypubinInput file pass phrase sourceOutput format, DER PEM PVKDon't print key outPrint the key in textPrint the DSA public valuepuboutpassoutCheck the DH parametersdsaparamInput format, DER or PEMOutput format, DER or PEMList digestsengine_implPrint as hex dumpbinaryPrint in binary formxoflenPrint debug infoSign digest using private keyprverifyFile with signature to verifyhmacCreate hashed MAC with keymacoptAny supported digestfips-fingerprintnocrlcertfileVerify CRL signatureInput file - default stdinoutput file - default stdoutOutput format - default PEMPrint hash valuenameoptCRL options: Print issuer DNSet lastUpdate fieldSet nextUpdate fieldNo CRL outputPrint the crl fingerprintPrint CRL numberbadsiggendeltano-CAfileno-CApathno-CAstoreOperation options: Encrypt messageDecrypt encrypted messageSign messageVerify signed messageresignResign a signed messagesign_receiptverify_receiptdigest_createdigest_verifyuncompressEncryptedData_encryptEncryptedData_decryptdata_createCreate a CMS "Data" objectdata_outcmsoutOutput CMS structureFile format options: rctformReceipt file formatEnable CMS streamingSame as -streamnoindefDisable CMS streamingcrlfeolasciicrlfKeys and passwords options: pwri_passwordsecretkeysecretkeyidinkeyoriginatorOriginator certificate filerecipRecipient cert filecert...aes128-wrapUse AES128 to wrap keyaes192-wrapUse AES192 to wrap keyaes256-wrapUse AES256 to wrap keydes3-wrapUse 3DES-EDE to wrap keydebug_decryptDigest algorithm to useSigner certificate input filecadesnodetachUse opaque signingnocertsnoattrnosmimecapno_signing_timereceipt_request_allreceipt_request_firstreceipt_request_fromreceipt_request_toVerification options: no_content_verifyno_attr_verifynosigsnoverifynointernverify_retcodeTrusted certificates fileUse subject key identifierecontent_typeOID for external contentCertificate output fileTo addressFrom addressSubjectPrinting options: receipt_request_printPrint CMS Receipt Request%s:%s:%d:CMP %s: expecting empty path or 'pkix/' but got '%s'%s%s specifications contained in keySpec from genp%s:%s:%d:CMP %s: Out of memory - cannot dump key %s%s%s %s:%s:%d:CMP %s: Info too large - cannot dump key %s%s%s Error allocating CMS_contentinfo Error reading %s Content Info Invalid key (supplied twice) %s Invalid id (supplied twice) %s Invalid OID (supplied twice) %s Illegal -inkey without -signer %s: Unknown option or message digest: %s %s: Unknown option or cipher: %s No Signed Receipts Recipients Signed receipts only allowed with -sign Multiple signers or keys not allowed Incompatible options: CAdES requires signed attributes Incompatible options: CAdES validation requires certs and signed attributes validations No signer certificate specified No recipient certificate or key specified No recipient(s) certificate(s) specified No operation option (-encrypt|-decrypt|-sign|-verify|...) specified. Warning: -nodetach option is ignored for non-signing operation Warning: -contfile option is ignored for the given operation Warning: recipient certificate file parameters ignored for operation other than -encrypt receipt signer certificate fileCannot use -digest for non-signing operation Cannot use -digest when -in, -nodetach or streaming is used Invalid hex value after -digest Cannot use originator for encryption Signed Receipt Request Creation Error Error decrypting CMS using secret key Error decrypting CMS using private key Error decrypting CMS using password Error decrypting CMS structure Receipt Request Parse Error Bad output format for CMS file Error initialising X509 store Error getting CRL issuer certificate Error getting CRL issuer public key Error getting maximum length of signed data key must be set for one-shot algorithms %s: Can only sign or verify one file. No signature to verify: use the -signature option MAC and signing key cannot both be specified Signature parameter error "%s" Error opening signature file %s Error reading signature file %s Length can only be specified for XOF Signing key cannot be specified for XOF Error, failed to set DH parameters %s: Value "%s" outside integer range Error, generator may not be chosen for DSA parameters Warning, input file %s ignored Error, %s param generation context allocation failed Generating %s parameters, %d bit long %sprime Error, unable to initialise %s parameters Error, unable to set DSA prime length Error, unable to set DH prime length Error, unable to set generator Error, unable to load parameters Error, unable to load DSA parameters Error, unable to load DH parameters Error, failed to check DH parameters Error, invalid parameters generated DH parameters appear to be ok. Error, unable to write DH parameters PVK form impossible with public key input bad output format specified for outfile Error, DSA parameter generation context allocation failed Warning: It is not recommended to use more than %d bit for DSA keys. Your key size is %d! Larger key size may behave not as expected. Generating DSA parameters, %d bit long prime Error, DSA key generation paramgen init failed Error, DSA key generation setting bit length failed Error, DSA key generation setting subprime bit length failed Error, unable to write DSA parameters Error, DSA key generation context allocation failed Error, unable to initialise for key generation %s:%s:%d:CMP %s: using only first %d characters of section name starting with "%.*s" %s:%s:%d:CMP %s: using section(s) '%s' of OpenSSL configuration file '%s'%s %s:%s:%d:CMP %s: no [%s] section found in config file '%s'; will thus use just [default] and unnamed section if present%s %s:%s:%d:CMP %s: no [%s] section found in config file '%s'%s %s:%s:%d:CMP %s: cannot load engine %s%s%s %s:%s:%d:CMP %s: cannot set up error reporting and logging for %s%s%s %s:%s:%d:CMP %s: -tls_used given without any other TLS options%s%s%s %s:%s:%d:CMP %s: ignoring TLS options(s) since -tls_used is not given%s%s%s %s:%s:%d:CMP %s: -tls_used option not supported with -port option%s%s%s %s:%s:%d:CMP %s: The -port option excludes -server and -use_mock_srv%s%s%s %s:%s:%d:CMP %s: The -port option does not support -reqin and -reqout%s%s%s %s:%s:%d:CMP %s: The -port option does not support -rspin and -rspout%s%s%s %s:%s:%d:CMP %s: cannot use both -server and -use_mock_srv options%s%s%s %s:%s:%d:CMP %s: ignoring -tls_used option since -server is not given or -use_mock_srv is given%s%s%s %s:%s:%d:CMP %s: must give -srv_ref for mock server if no -srv_cert given%s%s%s %s:%s:%d:CMP %s: server credentials (-srv_secret or -srv_cert) must be given if -use_mock_srv or -port is used%s%s%s %s:%s:%d:CMP %s: server will not be able to handle PBM-protected requests since -srv_secret is not given%s%s%s %s:%s:%d:CMP %s: must give both -srv_cert and -srv_key options or neither%s%s%s signer certificate of the mock serverprivate key for mock server cert%s:%s:%d:CMP %s: mock server will not be able to handle signature-protected requests since -srv_trusted is not given%s%s%s untrusted certificates for mock serverreference cert to be expected by the mock server%s:%s:%d:CMP %s: no -rsp_cert given for mock server%s%s%s cert the mock server returns on certificate requestsprivate key for enrollment certCRL to be returned by the mock serverCMP extra certificates for mock serverNewWithNew cert the mock server returns in rootCaKeyUpdateNewWithOld cert the mock server returns in rootCaKeyUpdateOldWithNew cert the mock server returns in rootCaKeyUpdate%s:%s:%d:CMP %s: -failure out of range, should be >= 0 and <= %d%s%s %s:%s:%d:CMP %s: -failurebits overrides -failure%s%s%s %s:%s:%d:CMP %s: -failurebits out of range%s%s%s %s:%s:%d:CMP %s: the -reqout_only client option does not combine with -port implying server behavior%s%s%s %s:%s:%d:CMP %s: -server %s%s%s option is ignored since -reqout_only option is given%s:%s:%d:CMP %s: -use_mock_srv %s%s%s %s:%s:%d:CMP %s: -reqout %s%s%s %s:%s:%d:CMP %s: -rspin %s%s%s %s:%s:%d:CMP %s: -rspout %s%s%s %s:%s:%d:CMP %s: -server option is not used if enough filenames given for -rspin%s%s%s %s:%s:%d:CMP %s: -use_mock_srv option is not used if enough filenames given for -rspin%s%s%s %s:%s:%d:CMP %s: cannot set up CMP context%s%s%s %s:%s:%d:CMP %s: Missing -cacertsout option for -infotype caCerts%s%s%s %s:%s:%d:CMP %s: no CA certificates provided by server%s%s%s %s:%s:%d:CMP %s: Failed to store CA certificates from genp in %s%s%s %s:%s:%d:CMP %s: Missing -newwithnew option for -infotype rootCaCert%s%s%s %s:%s:%d:CMP %s: No -oldwithold given, will use all certs given with -trusted as trust anchors for verifying the newWithNew cert%s%s%s OldWithOld cert for genm with -infotype rootCaCert%s:%s:%d:CMP %s: no root CA certificate update available%s%s%s %s:%s:%d:CMP %s: oldWithNew certificate received in genp for verifying oldWithOld, but oldWithOld was not provided%s%s%s %s:%s:%d:CMP %s: Missing -oldcrl and no -crlcert given for -infotype crlStatusList%s%s%s %s:%s:%d:CMP %s: Missing -crlout for -infotype crlStatusList%s%s%s Cert for genm with -infotype crlStatusListCRL for genm with -infotype crlStatusList%s:%s:%d:CMP %s: -oldcrl and -crlcert have different issuer%s%s%s %s:%s:%d:CMP %s: no CRL update available%s%s%s %s:%s:%d:CMP %s: received %s, saving to file '%s'%s %s:%s:%d:CMP %s: could not open file '%s' for writing %s%s error: unsupported type '%s' for writing CRLs %s:%s:%d:CMP %s: cannot write %s to file '%s'%s %s:%s:%d:CMP %s: no certificate request template available%s%s%s %s:%s:%d:CMP %s: error saving certTemplate from genp: cannot open file %s%s%s %s:%s:%d:CMP %s: error saving certTemplate from genp: cannot write file %s%s%s %s:%s:%d:CMP %s: stored certTemplate from genp to file '%s'%s%s %s:%s:%d:CMP %s: no key specifications available%s%s%s %s:%s:%d:CMP %s: error saving keySpec from genp: cannot open file %s%s%s %s:%s:%d:CMP %s: error saving keySpec from genp: cannot write file %s%s%s %s:%s:%d:CMP %s: stored keySpec from genp to file '%s'%s%s %s:%s:%d:CMP %s: No specific support for -infotype %s available%s%s %s:%s:%d:CMP %s: Failed to create genm for -infotype %s%s%s %s:%s:%d:CMP %s: Did not receive response on genm or genp is not valid%s%s%s %s:%s:%d:CMP %s: received%s%s %s Centrally generated private key password%s:%s:%d:CMP %s: saving centrally generated key to file '%s'%s%s Usage: %s [options] [numbits] [numqbits] Use engine e, possibly a hardware deviceNumber of bits if generating parameters or key (optional)Number of bits in the subprime parameter q if generating parameters or key (optional)Enable 'Strong' PVK encoding level (default)Enable 'Weak' PVK encoding levelInput format (DER/PEM/PVK); has no effectExpect a public key in input fileOutput public key, not privateOutput file pass phrase sourceUsage: %s [options] [numbits] Read or generate DSA parameters, convert to DHPrint a text form of the DH parametersDon't output any DH parametersGenerate parameters using 2 as the generator valueGenerate parameters using 3 as the generator valueGenerate parameters using 5 as the generator valueNumber of bits if generating parameters (optional)Usage: %s [options] [file...] Also use engine given by -engine for digest operationsPrint the digest with separating colonsPrint the digest in coreutils formatOutput to filename rather than stdoutKey file format (ENGINE, other values ignored)Output length for XOF algorithms. To obtain the maximum security strength set this to 32 (or greater) for SHAKE128, and 64 (or greater) for SHAKE256Verify a signature using public keyVerify a signature using private keyCreate MAC (not necessarily HMAC)MAC algorithm parameters in n:v form or keyCompute HMAC with the key used in OpenSSL-FIPS fingerprintFiles to digest (optional; default is stdin)No crl to load, just certs from '-certfile'File of chain of certs to a trusted CA; can be repeatedCRL input format (DER or PEM); has no effectCRL signing Private key to usePrivate key file format (DER/PEM/P12); has no effectPrint out a text format versionPrint old-style (MD5) hash valueCertificate subject/issuer name printing optionsCorrupt last byte of loaded CRL signature (for test)Other CRL to compare/diff to the Input oneVerify CRL using certificates in dirVerify CRL using certificates in file nameVerify CRL using certificates in store URIDo not load the default certificates fileDo not load certificates from the default certificates directoryDo not load certificates from the default certificates storeUsage: %s [options] [cert...] Load a configuration file (this may load modules)Generate a signed receipt for a messageVerify receipts; exit if receipt signatures do not verifySign a pre-computed digest in hex notationCreate a CMS "DigestedData" objectVerify a CMS "DigestedData" object and output itCreate a CMS "CompressedData" objectUncompress a CMS "CompressedData" objectCreate CMS "EncryptedData" object using symmetric keyDecrypt CMS "EncryptedData" object using symmetric keyCopy CMS "Data" object to outputInput format SMIME (default), PEM or DEROutput format SMIME (default), PEM or DERTreat input as binary: do not translate to canonical formUse CRLF as EOL termination instead of LF onlyPerform CRLF canonicalisation when signingSpecific password for recipientUse specified hex-encoded key to decrypt/encrypt recipients or contentIdentity of the -secretkey for CMS "KEKRecipientInfo" objectInput private key (if not signer or recipient)Set public key parameters as n:v pairsInput private key format (ENGINE, other values ignored)Encryption and decryption options: Recipient certs (optional; used only when encrypting)The encryption algorithm to use (any supported cipher)Key wrap algorithm to use when encrypting with key agreementDisable MMA protection, return error if no recipient found (see doc)Extra signer and intermediate CA certificates to include when signingor to use as preferred signer certs and for chain building when verifyingInclude signingCertificate attribute (CAdES-BES)Don't include signer's certificate when signingDon't include any signed attributesOmit the SMIMECapabilities attributeOmit the signing time attributeWhen signing, create a receipt request for all recipientsWhen signing, create a receipt request for first recipientCreate signed receipt request with specified email addressCreate signed receipt targeted to specified addressSigner certificate(s) output fileSupply or override content for detached signatureDo not verify signed content signaturesDo not verify signed attribute signaturesDon't verify message signatureDon't verify signers certificateDon't search certificates in message for signerCheck signingCertificate (CAdES-BES)Exit non-zero on verification failureTrusted certificates directoryTrusted certificates store URIInclude or delete text MIME headersFor the -cmsout operation do not output the parsed CMS structureFor the -cmsout operation print out all fields of the CMS structureFor the -print option specifies various strings printing options/k[K;+xnaTG:0&A4@{k[N5t` B X. E8 EE E E E EF pH0pP0@0 !0 !! x!8! P!2T1D543355t5T5\6D6655555444T4$443EDGFEFFFFFGpG`GPG@G0G GNMlR\RMDR,R RNNN SRRRRRRRVU XXWWpW`WWUWWWtn_oSoGolnset_nameprev_itemossl_cmp_mock_srv_set1_keyOutossl_cmp_mock_srv_set1_crlOutossl_cmp_mock_srv_set1_oldWithNewossl_cmp_mock_srv_set_pollCountossl_cmp_mock_srv_set_checkAfterTimeossl_cmp_mock_srv_set_statusInfoossl_cmp_mock_srv_set_sendErrorsetup_srv_ctxsave_crlsave_templatesave_keyspecdo_genmprint_statuscmp_mainprint_keyspeccmp_serverThis command is not enabled in the Red Hat Enterprise Linux OpenSSL build, please consult Red Hat documentation to learn how to enable FIPS mode unable to set point conversion format unable to set asn1 encoding format unable to disable public key encoding unable to enable public key encoding CURVE DESCRIPTION NOT AVAILABLEusing curve name prime192v1 instead of secp192r1 using curve name prime256v1 instead of secp256r1 Unable to load parameters from %s checking elliptic curve parameters: unable to write elliptic curve parameters hex string is too long, ignoring excess hex string is too short, padding with zero bytes to length *** WARNING : deprecated key derivation used. Using -iter or -pbkdf2 would be better. warning: iv not used by this cipher Either a raw key or the 'skeyopt' args must be used. Error creating opaque key object for skeymgmt %s Error setting an opaque key for cipher %s %s: Cannot mix flags and engine names. unable to create PKEY context unable to set up for key generation unable to output generated key retrievable algorithm parametersretrievable operation parametersunknown type (%u) of %zu bytes settable key generation parameters Provided Asymmetric Encryption: Provided RNGs and seed sources: ERROR: could not list all provider signature algorithms No TLS sig algs registered by currently active providersERROR: setting TLS protocol version ERROR: getting implemented TLS group list WARNING: Unable to query provider parameters for %s Invalid command '%s'; type "help" for a list. Error initializing %s context The possible -pkeyopt arguments are: Error reading parameter file %s %s: Error setting %s parameter: Cannot use cipher with -genparam option Error writing to outpubkey: '%s'. Error: %s Error writing to outfile: '%s'. Error: %s Warning: It is not recommended to use more than %d bit for RSA keys. Your key size is %d! Larger key size may behave not as expected. Error allocating RSA public exponent Error setting RSA public exponent Error setting number of primes Certificate input, or CSR input file with -req (default stdin)Private key and cert file pass-phrase sourceGenerate a certificate from scratchOutput a certification request (rather than a certificate)Input is a CSR file (rather than a certificate)copy extensions when converting from CSR to x509 or vice versaCSR verification parameter in n:v formKey for signing, and to include unless using -force_pubkeyKey input format (ENGINE, other values ignored)Output format (DER or PEM) - default PEMNo cert output (except for requested printing)No output (except for requested printing)Certificate printing options: Print the certificate in text formVarious certificate text printing optionsPrint the certificate fingerprintPrint both notBefore and notAfter fieldsSynonym for -subject_hash (for backward compat)Print old-style (MD5) subject hash valuePrint old-style (MD5) issuer hash valueRestrict which X.509 extensions to print and/or copyPrint OCSP hash values for the subject name and public keyPrint out certificate purposesPrint the public key in PEM formatCertificate checking options: Check whether cert expires in the next arg secondsExit 1 (failure) if so, 0 if notCheck certificate matches hostCheck certificate matches emailCheck certificate matches ipaddrSerial number to use, overrides -CAserialIncrement current certificate serial numberNumber of days until newly generated certificate expires - default 30Preserve existing validity datesSet or override certificate issuerSet or override certificate subject (and issuer)Key to be placed in new certificate or certificate requestDo not take over any extensions from the source certificate or requestConfig file with X509V3 extensions to addSection of extfile to use - default: unnamed sectionSignature parameter, in n:v formCorrupt last byte of certificate signature (for test)Any supported digest, used for signing and printingUse the given CA certificate, conflicts with -keyCA cert format (PEM/DER/P12); has no effectThe corresponding CA key; default is -CA argCA key format (ENGINE, other values ignored)File that keeps track of CA-generated serial numberCreate CA serial number file if it does not existCertificate trust output options: Mark certificate PEM output as trustedSet certificate alias (nickname)Trust certificate for a given purposeClears all the prohibited or rejected uses of the certificateReject certificate for a given purposeShow some internal datatype optionsPrint extra information about the operations being performed.A file of trusted certificatesA directory of files with trusted certificatesURI to a store of trusted certificatesDo not load the default trusted certificates fileDo not load trusted certificates from the default directoryDo not load trusted certificates from the default certificates storeA file of untrusted certificatesFile containing one or more CRL's (in PEM format) to loadTry downloading CRL information for certificates via their CDP entriesDisplay information about the certificate chainCertificate(s) to verify (optional; stdin used otherwise)Section to use within config fileFile with private key for replySearch by issuer and serial, issuer nameSearch by issuer and serial, serial numberSearch by public key fingerprint, given in hexPrint a text form of the objectsUsage: %s [options] [user...] The particular srp definition to useModify the SRP verifier of an existing userDelete user from verifier fileSet g and N values to be used for new verifierAdditional info to be set for userUsername(s) to process (optional)Specify the name of an SPKAC-dedicated section of configurationCreate SPKAC using private keySign new SPKAC with the specified digest (default: MD5)Usage: %s [options] [algorithm...] All +int options consider prefix '0' as base-8 input, prefix '0x'/'0X' as base-16 input. Enable (tls1>=1) multi-block mode on EVP-named cipherProduce machine readable outputEnable async mode and start specified number of jobsSpecify number of primes (for RSA only)Lock memory for better result determinismRun the speed command in test modeUse EVP-named cipher or digestTime decryption instead of encryption (only EVP)Benchmark EVP-named AEAD cipher in TLS-like sequenceBenchmark signature algorithmsUse wall-clock time instead of CPU user time as divisorRun benchmarks for specified amount of secondsRun [non-PKI] benchmarks on custom-sized bufferUse specified offset to mis-align buffersAlgorithm(s) to test (optional; otherwise tests all)Digest algorithm to use when signing or resigningDon't translate message to textDon't include signers certificate when signingVerification/Decryption options: Recipient certificate file for decryptionset PKCS7_NOCHAIN so certificates contained in the message are not used as untrusted CAsRecipient certs, used when encryptingKey options as opt:value for opaque keys handlingSymmetric key management name for opaque keys handlingGenerate an opaque symmetric keyThe cipher to generate key forInput format - default PEM (DER or PEM)Output format - default PEM (PEM, DER or NSS)Don't output the encoded session infoWhere to connect as post:port (default is localhost:4433)Specify TLSv1.3 ciphersuites to be usedTurn on peer certificate verification, set depthSeconds to collect data, default 30Fetch specified page from the siteCert file to use, PEM format assumedFile with key, PEM; default is -cert fileDo not load certificates from the default certificates store URIConfigure SSL_CTX using the given configuration valueTCP/IP port to listen on for connections (default is 4433)TCP/IP optional host and port to listen on for connections (default is *:4433)Unix domain socket to accept onFor -unix, unlink existing socket firstDon't use any certificates (Anon-DH)Turn on peer certificate verificationTurn on peer certificate verification, must have a certServer certificate file to use; default server.pemCertificate file to use for servername; default server2.pemServer certificate file format (PEM/DER/P12); has no effectServer certificate chain file in PEM formatBuild server certificate chainPEM serverinfo file for certificatePrivate key file to use; default is -cert file or elseserver.pem-Private Key file to use for servername if not in -cert2Key format (ENGINE, other values ignored)Private key and cert file pass phrase sourceSecond server certificate file to use (usually for DSA)Second server certificate file format (PEM/DER/P12); has no effectsecond server certificate chain file in PEM formatSecond private key file to use (usually for DSA)Second key file format (ENGINE, other values ignored)Second private key and cert file pass phrase sourceServername for HostName TLS extensionOn servername mismatch send fatal alert (default warning alert)Test with the non-blocking test bioConvert LF from terminal into CRLFDisable caching and tickets if ephemeral (EC)DH is usedRespond to a 'GET /' with a status pageRespond to a 'GET with the file ./pathDo not treat lack of close_notify from a peer as an errorHex dump of all TLS extensions receivedLike -WWW but ./path includes HTTP headersGenerate SSL/TLS session IDs prefixed by argExport keying material using labelExport len bytes of keying material; default 20CRL file format (PEM or DER); default PEMDownload CRLs from distribution points in certificate CDP entriesCA file for certificate chain (PEM format)use dir as certificate store path to build CA certificate chainuse URI as certificate store to build CA certificate chainCA file for certificate verification (PEM format)use dir as certificate store path to verify CA certificateuse URI as certificate store to verify CA certificateDisable internal cache, set up and use external cacheClose connection on verification errorNo verify output except verify errorsIgnore input EOF (default when -quiet)Pre-compress server certificatesRequest certificate status from serverPrint more output in certificate status callbackStatus request responder timeout[http[s]://]host[:port][/path] of HTTP(S) proxy to use; path is ignoredFile containing DER encoded OCSP ResponsePrint output from SSL/TLS security frameworkPrint more output from SSL/TLS security frameworkRestrict output to brief summary of connection parametersact as an echo server that sends back received text reversedFile to send output of -msg or -trace, instead of stdoutMaximum number of encrypt/decrypt pipelines to be usedTerminate after #num connectionsDefault read buffer size to be used for connectionsSize used to split data for encrypt pipelinesFile to read PSK SSL session from(deprecated) The verifier file for SRP(deprecated) A seed string for a default user saltProtocol and version options: The maximum number of bytes of early data as advertised in ticketsThe maximum number of bytes of early data (hard limit)The number of TLSv1.3 session tickets that a server will automatically issueSwitch on anti-replay protection (default)Switch off anti-replay protectionopening files in binary mode when acting as http server (-WWW and -HTTP)Disable TLS Extension CA NamesListen for a DTLS ClientHello with a cookie and then connectOffer SRTP key management with a colon-separated profile listSet the advertised protocols for the NPN extension (comma-separated list)Set the advertised protocols for the ALPN extension (comma-separated list)Enable Kernel TLS for sending and receivingUse sendfile to response file with -WWWUse zerocopy mode of KTLS sendfileEnable raw public keys (RFC7250) from the serverEnable raw public keys (RFC7250) from the clientDisable SSL/TLS compression (default)Disable sending TLSv1.3 compressed certificatesDisable receiving TLSv1.3 compressed certificatesDisable use of TLS session ticketsUse server's cipher preferencesEnable use of legacy renegotiation (dangerous)Allow client-initiated renegotiationAllow initial connection to servers that don't support RIDisallow session resumption on renegotiationDisallow initial connection to servers that don't support RIIn TLSv1.3 allow non-(ec)dhe based key exchange on resumptionIn TLSv1.3 prefer non-(ec)dhe over (ec)dhe-based key exchange on resumptionPrioritize ChaCha ciphers when preferred by clientsEnforce strict certificate checks as per TLS standardSignature algorithms to support (colon-separated list)Signature algorithms to support for client certificate authentication (colon-separated list)Groups to advertise (colon-separated list)Elliptic curve used for ECDHE (server-side only)Specify TLSv1.2 and below cipher list to be usedSpecify the minimum protocol version to be usedSpecify the maximum protocol version to be usedBlock size to pad TLS 1.3 records to.Perform all sorts of protocol violations for testing purposesDisable TLSv1.3 middlebox compat modeDisable Encrypt-then-Mac extensionDisable Extended master secret extensionExtended certificate options: cert for Extended certificateschain for Extended certificatesbuild certificate chain for the extended certificatesformat of Extended certificate (PEM/DER/P12); has no effectformat of Extended certificate's key (DER/PEM/P12); has no effectUsage: %s [options] [host:port] Specify engine to be used for client certificate operationsUse specified section for SSL_CTX configurationRequest and parse SCTs (also enables OCSP stapling)Do not request or parse SCTs (default)TCP/IP where to connect; default: 4433)bind local address for connectionConnect to via specified proxy to the real serverUserID for proxy authenticationProxy authentication password sourceConnect over the specified Unix-domain socketEnable Maximum Fragment Length Negotiation (len values: 512, 1024, 2048 and 4096)Client certificate file to useClient certificate file format (PEM/DER/P12); has no effectClient certificate chain file (in PEM format)Build client certificate chainPrivate key file to use; default: -cert filePEM format file of CA names to send to the serverDANE TLSA rrdata presentation formDisable name checks when matching DANE-EE(3) TLSA recordsHostname to use for "-starttls lmtp", "-starttls smtp" or "-starttls xmpp[-server]"Drop and re-make the connection with the same Session-IDIgnore input eof (default when -quiet)Use the appropriate STARTTLS command before starting TLSAlias of -name option for "-starttls xmpp[-server]"Print session information when the program exitsDon't run the client in the interactive modeShow all certificates sent by the serverEnable security debug messagesOutput more security debug outputShow trace output of protocol messagesDo not use interactive command lettersSet TLS extension servername (SNI) in ClientHello (default)Do not send the server name (SNI) extension in the ClientHellotypes Send empty ClientHello extensions (comma-separated numbers)Enable ALPN extension, considering named protocols supported (comma-separated list)Support asynchronous operationEnable send/receive timeout on DTLS connectionsEnable NPN extension, considering named protocols supported (comma-separated list)Enable post-handshake-authentication(deprecated) SRP authentication for 'user'(deprecated) Password for 'user'(deprecated) SRP username into second ClientHello message(deprecated) Tolerate other than the known g N values.(deprecated) Minimal length in bits for NDownload CRL from distribution pointsCRL format (PEM or DER); default PEMRestrict verify output to errorsUse dir as certificate store path to build CA certificate chainCA store URI for certificate chainUse dir as certificate store path to verify CA certificateCA store URI for certificate verificationWhere to connect; same as -connect optionInput key, by default an RSA private keyPrivate key format (ENGINE, other values ignored)Input key is an RSA public pkeyInput is a cert carrying an RSA public keyReverse the order of the input bufferUse PKCS#1 v1.5 padding (default)Run output through asn1parse; useful with -verifyInput format (DER/PEM/P12/ENGINE)Output format, one of DER PEM PVKUse traditional format for private keysSpecify the cipher for private key encryptionSpecify engine to be used for key generation operationsX.509 request input file (default stdin)Verify self-signature on the requestConfig section to use (default "req")Input characters are UTF8 (default ASCII)Output an X.509 certificate structure instead of a cert requestRequest cert generation with X.509 version 1Issuer cert to use for signing a cert, implies -x509Issuer private key to use with -CA; default is -CA argSet or modify subject of request or certPrint the subject of the output request or certNumber of days certificate is valid forcopy extensions from request when using -x509Cert or request extension section (override value in config file)Additional cert extension key=value pair (may be given more than once)Add a poison extension to generated cert (implies -new)Key for signing, and to include unless -in givenPrivate key and certificate password sourceGenerate new key with [:] or [:] or param:Public key options as opt:valueDo not ask anything during request generationDon't encrypt private keys; deprecatedOutput "NEW" in the header linesUsage: %s [options] [directory...] Create both new- and old-style hash linksUse old-style hash to generate linksOne or more directories to process (optional)Usage: %s [options] num[K|M|G|T] Usage: %s [options] [number...] When used with -generate, generate a safe primeNumber(s) to check for primality if not generatingAlso use engine given by -engine for crypto operationsSign input data with private keyEncrypt input data with public keyDecrypt input data with private keyDerive shared secret from own and peer (EC)DH keysInput key, by default private keyPeer key file used in key derivationPeer key format (DER/PEM/P12/ENGINE)Input is a cert with a public keySignature file (verify operation only)File to store secret on encapsulationparse the output as ASN.1 data to check its DER encoding and print errorsVerify RSA signature, recovering original signature input dataSigning/Derivation/Encapsulation options: Indicate that the signature/verification input data is not yet hashedThe digest algorithm to use for signing/verifying raw input data. Implies -rawinPublic key option that is read as a passphrase argument opt:passphraseKEM operation specific to the key algorithmDon't output encoded parametersRead only public components from key inputOutput file for encoded and/or text outputOutput encoding format (DER or PEM)Any supported cipher to be used for encryptionOutput PEM file pass phrase sourceUse traditional format for private key PEM outputRestrict encoded output to public componentsDo not output the key in encoded formOutput key components in plaintextOutput only public key components in text formSpecifies the EC point conversion form in the encodingSpecifies the way the EC parameters are encodedSet the PRF algorithm to use with PKCS#5 v2.0Use or expect unencrypted private keyuse traditional format private keySpecify the salt length (in bytes)Default: 8 (For PBE1) or 16 (for PBE2)Print full details of certificatesPrint out all fields of the PKCS7 structurePrint_certs print any certs or crl in the inputWhen used with -print_certs, it produces a cleaner outputSet PKCS#12 import/export password sourceSeparate MAC, encryption passwordsDon't output anything, just verify PKCS#12 inputUse legacy encryption: 3DES_CBC for keys, RC2_CBC for certsPKCS#12 import (parsing PKCS#12) options: Print info about PKCS#12 structureOnly output client certificatesAny supported cipher for output encryptionPKCS#12 output (export) options: Private key, else read from -in input fileExtra certificates for PKCS12 outputCertificate file pass phrase sourceBuild and add certificate chain for EE cert,which is the 1st cert from -in matching the private key (if given)Untrusted certificates for chain buildingUse name as CA friendly name (can be repeated)Add local machine keyset attribute to private keySet key type to MS key exchangeSet key type to MS key signaturePrivate key PBE algorithm (default AES-256 CBC)Certificate PBE algorithm (default PBES2 with PBKDF2 and AES-256 CBC)Encrypt output with 3DES (default PBES2 with PBKDF2 and AES-256 CBC)Digest algorithm to use in MAC (default SHA256)Use PBMAC1 with PBKDF2 instead of MACDigest to use for PBMAC1 KDF (default SHA256)Specify the iteration count for encryption and MACDon't use encryption iterationUnused, kept for backwards compatibilityMark certificate in PKCS#12 store as trusted for JDK compatibilityUsage: %s [options] [password] Never verify when reading password from terminalSHA512-based password algorithmSHA256-based password algorithmMD5-based password algorithm, Apache variantAIX MD5-based password algorithmPassword text to digest (optional)Ignore error on OCSP request or response and continue runningConnection timeout (in seconds) to the OCSP responderDon't include any certificates in responserun multiple responder processesDon't include any certificates in signed requestCorrupt last byte of loaded OCSP response signature (for test)Number of minutes before next updateNumber of requests to accept (default unlimited)File with the DER-encoded requestCertificate to sign OCSP request withAdditional certificates to include in signed requestNumber of days before next updateResponder certificate to sign responses withResponder key to sign responses withResponder key pass phrase sourceOther certificates to include in responseDigest Algorithm to use in signature of OCSP responseOCSP response signature parameter in n:v formUse specified algorithm for cert id in responseAny supported digest algorithm (sha1,sha256, ... )TCP/IP hostname:port to connect toDon't add OCSP nonce to requestDon't check signature on responseIdentify response by signing certificate key IDDon't check signing certificatePrint text form of request and responseDon't do additional checks on signing certificateDo not explicitly check the chain, just verify the rootDon't verify additional certificatesDon't search certificates contained in response for signerFile with the DER-encoded responseAdditional certificates to search for signerCertificate to check; may be given multiple timesSerial number to check; may be given multiple timesMaximum validity discrepancy in secondsPrivate key to sign OCSP request withOutput file for the DER-encoded requestOutput file for the DER-encoded responseMAC algorithm parameters in n:v formSee 'PARAMETER NAMES' in the EVP_MAC_ docsInput file to MAC (default is stdin)Output in binary format (default is hexadecimal)Usage: help [options] [command] Name of command to display help (optional)Set options for strict FIPS complianceVerify a config file instead of generating oneFile name of the provider moduleFIPS Provider config section name (optional)Disable the ability of the fips module to enter an error state if any conditional self tests failDisable the run-time FIPS security checks in the moduleForces self tests to always run on module loadForces self tests to run once on module installationEnable the run-time FIPS check for EMS during TLS1_PRFDisallow truncated digests with Hash and HMAC DRBGsEnable checking for approved digests for signaturesEnable digest check for TLS13-KDFEnable digest check for TLS1-PRFEnable digest check for SSHKDFEnable digest check for X963KDFDisallow Triple-DES encryptionDisallow PKCS#1 version 1.5 padding for RSA encryptionEnable salt length check for RSA-PSS signature operationsDisallow X931 Padding for RSA signingEnable key check for TLS13-KDFDisable lower bound check for PBKDF2Enable Cofactor check for ECDHInput config file, used when verifyingOutput config file, used when generatingMAC algorithm parameters in n:v form.Disable logging of self test eventsCorrupt a self test by descriptionList of message digest commands (deprecated)List of message digest algorithmsList of key derivation and pseudo random function algorithmsList the primary, public and private random number generator detailsList of random number generatorsList of message authentication code algorithmsList of cipher commands (deprecated)List of symmetric cipher algorithmsList of symmetric key managersList of key exchange algorithmsList of key encapsulation mechanism algorithmsList of TLS signature algorithmsList of asymmetric cipher algorithmsList implemented TLS key exchange 'groups'List implemented TLS key exchange 'groups' and all aliasesWhen listing 'groups', list those compatible with TLS1.2When listing 'groups', list those compatible with TLS1.3List options for specified commandList built in objects (OID<->name mappings)KDF algorithm control parameters in n:v formSee 'Supported Controls' in the EVP_KDF_ docs The size of the output derived keyDefault configuration file directoryDefault engine module directoryDefault module directory (other than engine modules)Configured extension for modules(deprecated) Use 3 for the E valueUse the Fermat number F4 (0x10001) for the E valueOutput the key to specified fileEncrypt the output with any supported cipherOutput status while generating keysDo not output status while generating keysSet the public key algorithm option as opt:valueCipher to use to encrypt the keyOrder of options may be important! See the documentation. Usage: %s [options] dsaparam-file Output the key to the specified fileFile containing DSA parametersUsage: %s [options] errnum... Usage: %s [options] engine... Check that specified engine is availableRun command against the ENGINE before loading itRun command against the ENGINE after loading itList 'control commands' For each specified engineAlso display each command's descriptionAlso add the input flags for each commandAlso show internal input flagsList the capabilities of specified engineDisplay error trace for unavailable enginesCommands are like "SO_PATH:/lib/libdriver.so"Base64 encode/decode, depending on encryption flagUsed with -[base64|a] to specify base64 buffer as a single lineDisable standard block paddingUse specified digest to create a key from the passphraseSpecify the iteration count and force the use of PBKDF2Use password-based key derivation function 2 (PBKDF2)Use -iter to change the iteration count from 10000Specify the PBKDF2 salt length (in bytes)Compress or decompress encrypted data using zlibKey options as opt:value for opaque symmetric key handlingSymmetric key management name for opaque symmetric key handlingPrints a list of all curve 'short names'Print the ec parameters in text formSpecifies the way the ec parameters are encodedCheck that named EC curve parameters have not been modifiedIf 'explicit' parameters are chosen do not use the seedUse the ec parameters with specified 'short name'Specifies the point conversion form Print the elliptic curve parametersexclude public key from private keypoint-formatinclude-publicunable to print EC key unable to check EC key EC Key Invalid! EC Key valid. writing EC key unable to write EC key apps/ec.cread EC key %s => %s prime192v1prime256v1list curvesapps/ecparam.c %-10s: secp192r1secp256r1groupSM2sm2unable to generate key EC parametersECSM2 parametersunable to clear seed unable to print params group-checkunable to set check_type algorithm nameapps/kdf.cnon-hex digit base64zlibSupported ciphers: %s Can't read key from %s %s: out of memory bufsize=%d strbufevp bufferUnstreamable cipher mode encryptiondecryptionenter %s %s password:bad password read invalid hex salt value RAND_bytes failed error writing output file error reading input file bad magic number PKCS5_PBKDF2_HMAC failed EVP_BytesToKey failed invalid hex iv value iv undefined invalid hex key value Error setting cipher %s salt=key=iv =bad encrypt bad decrypt bytes read : %8ju bytes written: %8ju apps/enc.c%s: zero length password engine bufferapps/engine.cSTORE(%s)Loaded: (%s) %s RAND [%s] [ available ] [ unavailable ] description buffer%s%s(input flags): [Internal] STRINGNUMERIC|NO_INPUT<0x%04X> %lxparams fileapps/gendsa.cUndefined%s: Only one item allowed %s: No items chosen Invalid KDF name %s KDF parameter error Invalid derived key length. out bufferEVP_KDF_derive failed %s ERROR: Memory allocation %sLegacy: %sProvided: @ %s description: %s %*sEmpty list of %s (!!!) settable operation parametersProvided MACs: Provided KDFs and PDFs: uninitialisedready %s state = %s state%*s%s: %llu error getting value %lld <%zu bytes> Provided ENCODERs: @ %s (%s) Provided DECODERs: Name: Type: Provider Algorithm IDs: tls-sigalg-iana-nameTLS-SIGALG%-*sProvided STORE LOADERs: ExternalBuiltin(none)- - %s %c Digests: Symmetric Ciphers: Provided Key Exchange: Provided Signatures: Provided Key encapsulation: Provided Key managers: primaryprivateapps/list.c%s%c Key Managers: Name: %s Alias for: %s Type: %s Algorithm OID: %s PEM string: %s Encryption: Providers: buildinfo name: %s version: %s status: %sactive build info: %s gettable provider parametersEngines: Disabled algorithms: EC2M MDC2 SM2 SM4 SSL3 BROTLI ZSTD # None-OID object: %s, %s %s = %s %s = %s, %s uintfloat %s%s:%s Can't open parameter file %s Error initializing context Bad format specified for key Error writing key(s) Error printing key apps/genpkey.cAlgorithm already set! Error setting RSA length Error cannot access RSA e e is %s (0x%s) apps/genrsa.capps/mac.cx509toreqsignkeySame as -keyOutput file - default stdoutnocertcertoptPrint certificate aliasPrint serial number valuePrint the notBefore fieldPrint the notAfter fieldPrint subject DNPrint email address(es)subject_hashPrint subject hash valuesubject_hash_oldissuer_hashPrint issuer hash valueissuer_hash_oldocspidocsp_uriPrint OCSP Responder URL(s)Print the RSA key moduluscheckendcheckhostcheckemailcheckipCertificate output options: set_serialnext_serialpreserve_datesset_issuerAlias for -set_subjectforce_pubkeyclrextMicro-CA options: CAformCAkeyCAkeyformCAserialCAcreateserialtrustoutsetaliasclrtrustClear all trusted purposesaddtrustclrrejectaddrejectShow all dataShow build dateShow configuration directoryShow engines directoryShow modules directoryShow compiler flags usedShow target build platformShow random seeding optionsShow library versionShow CPU settings infoCertificate chain options: CRLfilecrl_downloadshow_chainConfiguration fileSigner certificate fileFile with signer CA chainFile with trusted CA certsPath to trusted CA filesURI to trusted CA storeExtra untrusted certstoken_inInput is a PKCS#7 filetoken_outOutput is a PKCS#7 fileQuery options: Generate a TS queryFile to hashDigest (as a hex string)queryfileFile containing a TS queryPut cert request into queryVerify options: Verify a TS responseGenerate a TS replytspolicyPolicy OID to useno_nonceDo not include a nonceOutput text (not DER)Usage: %s [options] uri Search options: Search for certificates onlySearch for keys onlycrlsSearch for CRLs onlySearch by subjectSearch by aliasRecurse through namesNo PEM output, just statusURI of the store objectTalk a lot while doing thingsAction options: Add a user and SRP verifiermodifydeleteList userssrpvfileThe srp verifier file nameuserinfospksectchallengeChallenge stringAlternative SPKAC nameDon't print SPKACOutput public keyVerify SPKAC signaturembmrRun benchmarks in parallelasync_jobsmlocktestmodeSelection options: evpHMAC using EVP-named digestcmacCMAC using EVP-named cipheraeadkem-algorithmsBenchmark KEM algorithmsTiming options: elapsedmisalignpk7outOutput PKCS#7 structureSigning/Encryption options: Email options: nochainskeyoptskeymgmtSet the session ID contextPrint ssl session id detailsOutput certificate Connection options: Just time new connectionsJust time connection reusebugsTurn on SSL bug compatibilityJust use TLSv1.0Just use TLSv1.1Just use TLSv1.2Just use TLSv1.3wwwcafilePEM format file of CA'sPEM format directory of CA'sURI to store of CA'sssl_configtracetrace protocol messagesNetwork options: unixunlinkUse IPv4 onlyUse IPv6 onlyIdentity options: Set session ID contextcert2build_chainserverinfokey2dcertformdcert_chaindkeydkeyformdpassdhparamDH parameters file to useservername_fatalnbio_testNo server outputno_resume_ephemeralWWWignore_unexpected_eoftlsextdebugHTTPid_prefixkeymatexportkeymatexportlenCRL file to useCRLformchainCAfilechainCApathchainCAstoreverifyCAfileverifyCApathverifyCAstoreno_cacheDisable session cacheext_cacheverify_return_errorverify_quietno_ign_eofDo not ignore input EOFOCSP options: status_verbosestatus_timeoutstatus_urlStatus request fallback URLstatus_fileDebug options: security_debugsecurity_debug_verbosebriefPrint more outputmsgShow protocol messagesmsgfilePrint the SSL statesasyncOperate in asynchronous modemax_pipelinesnacceptkeylogfileWrite TLS secrets to filenbioUse non-blocking IOEnable timeoutsmtuSet link-layer MTUread_bufsplit_send_fragmax_send_fragMaximum Size of send frames Server identity options: PSK identity to expectpsk_hintPSK identity hint to usePSK in hex (without 0x)psk_sessionsrpuserseedrecv_max_early_dataAttempt to read early datanum_ticketsno_anti_replayhttp_server_binmodeno_ca_namesstatelessRequire TLSv1.3 cookiesJust talk TLSv1Just talk TLSv1.1just talk TLSv1.2just talk TLSv1.3dtlsUse any DTLS versionlistendtls1Just talk DTLSv1dtls1_2Just talk DTLSv1.2sctpUse SCTPsctp_label_bugEnable SCTP label length buguse_srtpno_dheDisable ephemeral DHnextprotonegalpnktlszerocopy_sendfileenable_server_rpkenable_client_rpkTLS/SSL options: no_ssl3Just disable SSLv3no_tls1Just disable TLSv1no_tls1_1Just disable TLSv1.1no_tls1_2Just disable TLSv1.2no_tls1_3Just disable TLSv1.3no_compUse SSL/TLS-level compressionno_tx_cert_compno_rx_cert_compno_ticketserverpreflegacy_renegotiationclient_renegotiationDisable all renegotiation.no_resumption_on_renegno_legacy_server_connectallow_no_dhe_kexprefer_no_dhe_kexprioritize_chachaclient_sigalgsnamed_curvemin_protocolmax_protocolrecord_paddingdebug_broken_protocolno_middleboxno_etmno_emsxkeykey for Extended certificatesxcertxchainxchain_buildxcertformxkeyformssl_client_enginenoctctlogfileCT log list CONF fileUse -connect insteadbindproxy_userproxy_passmaxfraglenfallback_scsvSend the fallback SCSVrequestCAfiledane_tlsa_domainDANE TLSA base domaindane_tlsa_rrdatadane_ee_no_namechecksPSK identitySession options: reconnectsess_outFile to write SSL session tosess_inFile to read SSL session fromInput/Output options: No s_client outputDon't ignore input eofstarttlsxmpphostprexitno-interactiveshowcertsExtra outputMore ssl protocol testingPrint the ssl statesnocommandsadvAdvanced command modenoservernameJust use TLSv1Use any version of DTLSquicUse QUICSet the link layer MTUJust use DTLSv1Just use DTLSv1.2File to send as early dataenable_phasrpusersrppasssrp_lateusersrp_moregroupssrp_strengthhost:portSign with private keyVerify with public keyEncrypt with public keyDecrypt with private keycertinrawUse no paddingpkcsx931Use ANSI X9.31 paddingoaepUse PKCS#1 OAEPasn1parsehexdumpHex dump outputVerify key consistencyRSAPublicKey_inInput is an RSAPublicKeyOutput a public keyRSAPublicKey_outOutput is an RSAPublicKeytraditionalPVK options: keygen_engineNew requestRequest template filereqoptVarious request text optionsText form of requestx509x509v1(Required by some CA's)Serial number to useAn alias for -extensionsaddextprecertKeys and Signing options: File to write private key topkeyoptnoencDon't encrypt private keysnodesDo not output REQnewhdrRSA moduluscompatDo not remove existing linksBase64 encode outputHex encode outputNumber of bytes to generateSize of number in bitsNumber of checksHex outputGenerate a primesafederivedecapDecapsulate shared secretencapEncapsulate shared secretInput key is a public keypeerkeypeerformsigfileverifyrecoverrawinpkeyopt_passinkdfUse KDF algorithmkdflenKDF algorithm output lengthkemopCheck key param consistencyPrint parameters as textCheck key consistencypubcheckCheck public key consistencyKey input pass phrase sourcetext_pubec_conv_formec_param_encUse PKCS#5 v1.5 and cipherv2Use PKCS#5 v2.0 and cipherv2prfInput format (DER or PEM)nocryptOutput format (DER or PEM)topk8Output PKCS8 fileSpecify the iteration countUse 1 as iteration countScrypt options: scryptUse scrypt algorithmscrypt_NSet scrypt N parameterscrypt_rSet scrypt r parameterscrypt_pSet scrypt p parameterDon't output encoded dataprint_certstwopassnokeysDon't output private keysDon't output certificateslegacynomacverDon't verify integrity MACclcertscacertsOnly output CA certificatesCreate PKCS12 filepasscertsPEM-format file of CA'sPEM-format directory of CA'sUse name as friendly namecanameCSPMicrosoft CSP nameLMKkeyexkeysigkeypbecertpbemacalgpbmac1_pbkdf2pbmac1_pbkdf2_mdnomaciterDon't use MAC iteration)macsaltlenSpecify the salt len for MACnomacDon't generate MACjdktrustRead passwords from fileRead passwords from stdinNo warningsFormat output as tablereverseSwitch table columnsCryptographic options: Use provided saltapr1MD5-based password algorithmaixmd5ignore_errResponder options: resp_no_certsnminnrequestsign_otherindexCertificate status index filendaysrsignerrotherrmdrsigoptkey=value header to addrcidClient options: Responder URLPort to run responder onPath to use in OCSP requestOutput filenameDon't verify response at allAdd OCSP nonce to requestno_signature_verifyresp_key_idno_cert_verifyreq_textPrint text form of requestresp_textPrint text form of responseno_chainDon't chain verify responseno_cert_checksno_explicittrust_otherno_internrespinVAfileValidator certificates fileverify_othervalidity_periodrespoutIssuer certificatestatus_ageMaximum status age in secondstoseqOutput NS Sequence fileUsage: %s [options] mac_name CipherDigestmac_nameMAC algorithmcommandpedanticmoduleprovider_nameFIPS provider namesection_nameno_conditional_errorsno_security_checksself_test_onloadself_test_oninstallems_checkno_short_macDisallow short MAC outputno_drbg_truncated_digestssignature_digest_checkhmac_key_checkEnable key check for HMACkmac_key_checkEnable key check for KMACEnable digest check for HKDFtls13_kdf_digest_checktls1_prf_digest_checksshkdf_digest_checksskdf_digest_checkEnable digest check for SSKDFx963kdf_digest_checkdsa_sign_disabledDisallow DSA signingtdes_encrypt_disabledrsa_pkcs15_padding_disabledrsa_pss_saltlen_checkrsa_sign_x931_disabledEnable key check for HKDFkbkdf_key_checkEnable key check for KBKDFtls13_kdf_key_checktls1_prf_key_checkEnable key check for TLS1-PRFsshkdf_key_checkEnable key check for SSHKDFsskdf_key_checkEnable key check for SSKDFx963kdf_key_checkEnable key check for X963KDFx942kdf_key_checkEnable key check for X942KDFno_pbkdf2_lower_bound_checkecdh_cofactor_checkcorrupt_desccorrupt_typeCorrupt a self test by typeThe parent config to verifyNo messages, just exit statusList in one columnVerbose listingselectSelect a single algorithmList of standard commandsstandard-commandsall-algorithmsList of all algorithmsdigest-commandsdigest-algorithmskdf-algorithmsrandom-instancesrandom-generatorsmac-algorithmscipher-commandsencodersList of encoding methodsdecodersList of decoding methodsList of key managersskey-managerskey-exchange-algorithmsList of signature algorithmstls-signature-algorithmsasymcipher-algorithmspublic-key-algorithmsList of public key algorithmspublic-key-methodsList of public key methodsstore-loadersList of store loadersall-tls-groupsprovidersList of provider informationList of loaded enginesList of disabled featuresobjectscmscrl2pkcs7dgstecparamerrstrfipsinstallgendsagenpkeygenrsanseqocsppasswdpkcs12pkcs8pkeyparampkeyutlrehashrsautls_clients_servers_timesess_idskeyutlsmimespeedstoreutlmd2md4sha224sha512-224sha512-256sha3-224sha3-256sha3-384sha3-512shake128shake256rmd160blake2b512blake2s256sm3aes-128-cbcaes-128-ecbaes-192-cbcaes-192-ecbaes-256-cbcaes-256-ecbaria-128-cbcaria-128-cfbaria-128-ctraria-128-ecbaria-128-ofbaria-128-cfb1aria-128-cfb8aria-192-cbcaria-192-cfbaria-192-ctraria-192-ecbaria-192-ofbaria-192-cfb1aria-192-cfb8aria-256-cbcaria-256-cfbaria-256-ctraria-256-ecbaria-256-ofbaria-256-cfb1aria-256-cfb8camellia-128-cbccamellia-128-ecbcamellia-192-cbccamellia-192-ecbcamellia-256-cbccamellia-256-ecbdes3desxidearc4rc4-40rc2bfcastrc5des-ecbdes-ededes-ede3des-cbcdes-ede-cbcdes-ede3-cbcdes-cfbdes-ede-cfbdes-ede3-cfbdes-ofbdes-ede-ofbdes-ede3-ofbidea-cbcidea-ecbidea-cfbidea-ofbseed-cbcseed-ecbseed-cfbseed-ofbrc2-cbcrc2-ecbrc2-cfbrc2-ofbrc2-64-cbcrc2-40-cbcbf-cbcbf-ecbbf-cfbbf-ofbcast5-cbccast5-ecbcast5-cfbcast5-ofbcast-cbcrc5-cbcrc5-ecbrc5-cfbrc5-ofbUsage: %s [options] kdf_name kdfoptkeylenkdf_nameName of the KDF algorithmconfigdirenginesdirmodulesdirdsoextdirnamesepDirectory-filename separatorlistsepList separator characterseedsSeed sourcescpusettingswindowscontextWindows install contextUsage: %s [options] numbits F4f4Specify number of primesSize of key in bitsparamfileParameters fileThe public key algorithmOutput (private key) fileoutpubkeyOutput public key fileoutput format (DER or PEM)genparamGenerate parameters, not keyPrint the private key in textdsaparam-fileerrnumError number(s) to decodeprepostvvvvttID of engine(s) to loadList ciphersAlias for -listEncryptDecryptPrint the iv/keyPrint the iv/key and exitPassphrasekfileRead passphrase from filePassphrase sourceSame as option -anopadUse salt in the KDF (default)nosaltDo not use salt in the KDFbufsizeBuffer sizeRaw key, in hexSalt, in hexIV in hexDefault: 10000Don't encryptDefault: 16uncompressedhybridlist_curvesGenerate ec keyInput file - default stdinDo not print the ec parameterParameter options: Validate the ec parameterscheck_namedno_seedcheck key consistencyPrint the keyparam_outno_public`P@0h@0h0HhXH8(H8xxx(PH8h#"$p$X$8$($#"&''&'t'd'T'D'4'$'**x*(P*8*))*A@t@AT@,@@,@`dadccTa$gggffeeeeeee|edeTeDe4e$eeeddddddtdddLd4d$d x`P8 pІ|TlT\D4|dL4$Salted__apps/rehash.cInvalid MAC name %s MAC parameter error EVP_MAC_Init failed Read Error in '%s' EVP_MAC_update failed EVP_MAC_final failed output len is too large subject=The command %s is deprecated. Use '%s' instead.--helpUsage: %s %s: Standard commandsPassword: apps/passwd.cprivate key from -in fileprivate key from -inkey filecertpbe and -descertiter and -noiterEnter MAC Password:Can't read Password certificates from -in fileError getting chain: %s Enter Export Password:Error creating PBMAC1 Enter Import Password:MAC: using PBKDF2, Iteration %ld PBKDF2 PRF: %s Warning: MAC is absent! apps/pkcs12.cPKCS12KDFPKCS7 Data PKCS7 Encrypted data: unable to load PKCS7 object %s: Unknown PBE algorithm %s %s: Unknown PRF algorithm %s Error converting key Error setting PBE algorithm Enter Encryption Password:Error encrypting key Error reading key Enter Password:Error decrypting key apps/pkcs8.cPublic KeyKey is valid Key is invalid apps/pkey.cError reading parameters Parameters are valid Parameters are invalid oneshot sign/verify bufferError reading raw input data buffer outputError signing raw input data apps/pkeyutl.c(unknown key type)%s: Error loading key Error: out of memory peer keyError reading peer key %s Enter %s: user abort entry failed failed to get '%s' Can't open signature file %s Error reading signature data Error reading input Data secret outputPublic Key operation error Key derivation failed isis notSpecify the number of bits. Out of memory. Failed to generate prime. apps/prime.cFailed to process value (%s) Error checking prime (%s) %s prime Missing number (s) to check Invalid size suffix %s buffer for output fileapps/rand.chash bucketcollision bucketError creating SSL context. application/ocsp-responseapplication/ocsp-request (core dumped)apps/ocsp.cissuer certificateError Creating OCSP request Error reading OCSP request responder certificateresponder other certificatesresponder private keychild PID arraywaitpid() failed: %sapps/lib/http_server.cRAND_poll() failedterminating on signal: %dindex file changed, reloadingsigner private keysigner certificatesError signing OCSP request assertion failed: bnassertion failed: itmpError reading OCSP response Responder Error: %s (%d) validator certificatesError parsing response Nonce Verify error Response Verify Failure Response verify OK ERROR: No Status found. This Update: Next Update: Reason: %s Revocation Time: apps_startupprog_initorg.openssl.engineOPENSSL_TEST_LIBCTXnull--h--version--vapps/openssl.cCannot write random bytes: apps/lib/app_rand.c%.*s %02X %s (%s) Skipping %s, can't write Doing %s Skipping %s, out of memory filename buffer%s%s%slink %s -> %s %s%s%08x.%s%d%s: Can't unlink %s, %s %s: Can't symlink %s, %s unlink %s crtcer%s: Error reading certs file %s %s: Error reading sequence file %s The command %s was deprecated in version %s. Message Digest commands (see the `dgst' command for more details) Cipher commands (see the `enc' command for more details) %s: Can't combine -in and -stdin Warning: -%s option ignored with -export Warning: output encryption option -%s ignored with -export Warning: -%s option ignored without -export Error getting certificate file password Option -twopass cannot be used with -passout or -password Option -twopass cannot be used with -passin or -password Nothing to export due to -noout or -nocerts and -nokeys Warning: -chain option ignored with -nocerts No certificate in -in file %s No cert in -in file '%s' matches private key No end entity certificate to check with -chain extra certificates from -certfileError creating PKCS12 structure for %s Error creating PKCS12 MAC; no PKCS12KDF support? Use -nomac or -pbmac1_pbkdf2 if PKCS12KDF support not available , Unsupported KDF or params for PBMAC1 Key length: %ld, Salt length: %d MAC length: %ld, salt length: %ld Error verifying PKCS12 MAC; no PKCS12KDF support. Use -nomacver if MAC verification is not required. Verbatim password did not match, and fallback conversion to UTF-8 failed The password entered or the input encoding may be wrong Mac verify error: invalid password? Warning: using broken algorithm Error outputting keys and certificates unable to allocate PKCS7 object Warning: The -text option is ignored with -text_pub Warning: The -traditional is ignored since there is no PEM output Warning: The -passout option is ignored without a cipher option Error: Cipher options are supported only for PEM output Error: Text output cannot be combined with DER output Error: unable to determine file size for oneshot operation Error verifying raw input data %s: no KDF length given (-kdflen parameter). %s: no private key given (-inkey parameter). %s: -peerkey option not allowed without -derive. %s: missing -peerkey option for -derive operation. A private key is needed for this operation %s: -verifyrecover can be used only with RSA %s: -rev cannot be used with raw input %s: -digest (prehash) is not supported with %s %s: -digest and -rawin can only be used with -sign or -verify The given KDF "%s" is unknown. %s: Error initializing context Type of peer public key: %s does not match type of private key: %s %s: Error setting up peer key %s: Can't set parameter "%s": %s: Signature file specified for non verify %s: No signature file specified for verify %s: Decapsulation produces only a shared secret and no output. The '-out' option is not applicable. KEM-based shared-secret derivation requires the '-secret ' option Error: The non-raw input data length %zd is too long - max supported hashed size is %d Signature Verified Successfully Signature Verification Failure %lu bytes with suffix overflows Request exceeds max allowed output %s: warning: skipping duplicate %s in %s %s: error: hash table overflow for %s Error querying OCSP responder %s Error parsing -url argument No issuer certificate specified Error converting serial number %s Missing = in header key=value %s: Digest must be before -cert or -serial Error loading responder certificate Responder mode requires certificate, key, and CA. error detaching from parent process group: %sinternal error: no matching child slot for pid: %ldchild process: %ld, exit status: %dchild process: %ld, term signal %d%swaiting for OCSP client connections...error reloading updated index: %sNeed an OCSP request for this operation! Error loading signer certificate WARNING: no nonce in response WARNING: Status times invalid. internal error: no free child slotsOpenSSL application user interfaceFailed to create null provider Failed to create library context FATAL: Startup failure (dev note: %s()) for %s %s: could not get default config file %s: error: skipping %s, cannot open file %s: warning: skipping %s, it does not contain exactly one certificate or CRL %s: error calculating SHA1 hash value 0}0}|P{||P||(PЍH8P@(xX ܕ̕|l\L<, ԗėtĖ\D,t\,̘l\L<\L@P@ 0pԸLĻtdT\,TD,|X@(`P@( p0P@x`H0 `pppp`P$\`HxhXH8( h P 8  ` @ ( ` P 8  x,443433333d5333333333333333335./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz$apps/req.cpkcs1PrivateKeyInfoRSA-PSSNot an RSA key Modulus=RSA key ok RSA key not ok writing RSA key apps/rsa.chold rsa keyoutput rsa keyRSA operation error apps/rsautl.cpsk_client_cb created identity '%s' len=%d apps/s_client.ccreated PSK len=%ld Error in PSK client callback Can't use SSL_get_servername SERVERINFO FOR EXTENSION %dhexdecode%s '%s' too long req_extensionsCan't find keygen engine %s Serial number supplied twice Duplicate extension name: %s Unknown cipher: %s input_passwordoutput_passworddefault_bitsUnable to determine key type Error setting keysize Key parameter error "%s" default_keyfileWriting private key to stdout encrypt_rsa_keyencrypt_key----- X509 requestissuer cert from -CA argpromptdistinguished_nameUnable to get '%s' section _min_maxDN defaultDN valueAttribute defaultAttribute valueError adding attribute Error getting public key Error printing certificate Modulus is unavailable Wrong Algorithm typeClient_identity<= < =<<<<= -1 Parse error on -addext: missing '=' Parse error on -addext: missing key Internal error handling -addext %s Warning: Ignoring -days without -x509; not generating a certificate Warning: Ignoring -not_before without -x509; not generating a certificate Warning: Ignoring -not_after without -x509; not generating a certificate Warning: Ignoring -copy_extensions 'none' when -x509 is not given Warning: Will read cert request from stdin since no -in option is given Using additional configuration from -addext options Problems opening '%s' for extra OIDs Error checking %s extension section %s Error checking extensions defined using -addext Warning: Not generating key via given -newkey option since -key is given Parameter file requested but no path given: %s Cannot open parameter file %s Key type does not match parameters Error allocating keygen context Error initializing keygen context Private key length too short, needs to be at least %d bits, not %ld. Warning: It is not recommended to use more than %d bit for RSA keys. Your key size is %ld! Larger key size may behave not as expected. Warning: It is not recommended to use more than %d bit for DSA keys. Your key size is %ld! Larger key size may behave not as expected. Warning: Not placing -key in cert or request since request is used Warning: Ignoring -in option since -new or -newkey or -precert is given Warning: Ignoring -CAkey option since no -CA option is given Issuer CA certificate and key do not match Must provide a signature key using -key or provide -CA / -CAkey Error: No objects specified in config file You are about to be asked to enter information that will be incorporated into your certificate request. What you are about to enter is what is called a Distinguished Name or a DN. There are quite a few fields but you can leave some blank For some fields there will be a default value, If you enter '.', the field will be left blank. Please enter the following 'extra' attributes to be sent with your certificate request No template, please set one up. Error making certificate request Warning: Not using -key or -newkey for signing since -CA option is given Warning: -not_after option overriding -days option Warning: No -copy_extensions given; ignoring any extensions in the request Error copying extensions from request Warning: Signature key and public key of cert do not match Error adding x509 extensions from section %s Error adding x509 extensions defined via -addext Error adding poison extension Warning: Ignoring -precert flag since no cert is produced Error adding request extensions from section %s Error adding request extensions defined via -addext Modifying subject of certificate request Error modifying subject of certificate request Certificate request self-signature verify failure Certificate request self-signature verify OK Error printing certificate request Unable to write certificate request Unable to write X509 certificate OCSP response: no response sent response parse error {help}: Get this help text DONE RECONNECTING RENEGOTIATING noreqKEYUPDATE ERROR --- Reused, --- New, --- Certificate chain %2d s: i: v:NotBefore: ; NotAfter: Server certificate Server raw public key no peer rpk available --- SCTs present (%i) SCT validation status: %s --- %s, Cipher is %s Protocol: %s Server public key is %d bit Compression: %s Expansion: %s Using Kernel TLS for sending Next protocol: (%d) ALPN protocol: No ALPN negotiated Early data was not sent Early data was rejected Early data was accepted Verify return code: %ld (%s) Keying material exporter: Label: '%s' Length: %i bytes export key Error Keying material: smtpIPv6 IPv4 unix mail.example.comlocalhostcbufsbufmbufError writing file %s Not a hex number '%s' %s: Value must be one of: %s: Can't use both -4 and -6 Can't use -sctp without DTLS Error getting proxy password client certificateclient certificate chainError adding CRL Unable to create BIO Error setting verify params Error loading CA names Error setting SRTP profile Error parsing -alpn argument Error setting ALPN Unable to set SRP username Can't open session file %s Can't set session Connecting via TFO apps/lib/s_socket.cConnecting to %s connect:errno=%d CONNECTED(%08X) memory allocation failure getsockname:errno=%d Failed to set MTU LHLO %s EHLO %s STARTTLSSTLS BIO_read failed . CAPABILITY . STARTTLS AUTH TLS To issue a command insert {cmd} or {cmd:arg} anywhere in the text Entering {{ will send { to the peer The following commands are available {quit}: Close the connection to the peer {reconnect}: Reconnect to the peer {fin}: Send FIN on the stream. No further writing is possible {keyup:req|noreq}: Send a Key Update message Arguments: req = peer update requested (default) noreq = peer update not requested {reneg}: Attempt to renegotiate a:PKEY: %s, (%s); sigalg: %s a:PKEY: %s, %d (bit); sigalg: %s no peer certificate available Client-to-server raw public key negotiated Server-to-client raw public key negotiated --- SSL handshake has read %ju bytes and written %ju bytes Using Kernel TLS for receiving SRTP Extension negotiated, profile=%s %s: Intermixed protocol flags (unix and internet domains) %s: Intermixed protocol flags (internet and unix domains) Cannot supply multiple protocol flags Cannot supply both a protocol flag and '-no_' Error getting client auth engine SRP minimal length for N is %d %s: Max Fragment Len %u is out of permitted values%s: cannot provide both -connect option and target parameter %s: Can't use -servername and -noservername together %s: Can't use -dane_tlsa_domain and -noservername together Cannot supply -nextprotoneg with TLSv1.3 %s: -connect argument or target parameter malformed or ambiguous %s: -proxy requires use of -connect or target parameter %s: -proxy argument malformed or ambiguous %s: -bind argument parameter malformed or ambiguous Can't use unix sockets and datagrams together Error parsing -nextprotoneg argument Error getting private key password Error: Must specify proxy_user with proxy_pass client certificate private keyError using configuration "%s" %s: Max send fragment size %u is out of permitted range %s: Split send fragment size %u is out of permitted range %s: Max pipelines %u is out of permitted range %s: Max Fragment Length code %u is out of permitted values Error loading store locations Error setting client auth engine PSK key given, setting client callback Can't open PSK session file %s Can't read PSK session file %s Warning: Unable to add custom extension %u, skipping %s: Error enabling DANE TLSA authentication. Error setting client certificate types Error setting server certificate types Unable to set TLS servername extension. %s: DANE TLSA authentication requires at least one -dane_tlsa_rrdata option. %s: warning: bad TLSA %s field in: %s %s: warning: unusable TLSA rrdata: %s %s: warning: error loading TLSA rrdata: %s %s: Failed to import any TLSA records. %s: DANE TLSA authentication requires the -dane_tlsa_domain option. %s: DTLS does not support the -tfo option %s: QUIC does not support the -tfo option %s: QUIC requires ALPN to be specified (e.g. "h3" for HTTP/3) via the -alpn option assertion failed: (family == AF_UNSPEC || family == BIO_ADDRINFO_family(ai)) && (type == 0 || type == BIO_ADDRINFO_socktype(ai)) && (protocol == 0 || protocol == BIO_ADDRINFO_protocol(ai))Can't bind %saddress for %s%s%s MTU too small. Must be at least %ld Failed to set the initial peer address Didn't find STARTTLS in server response, trying anyway... Timeout waiting for response (%d seconds). Server does not support STARTTLS. MySQL packet length does not match. Only MySQL protocol version 10 is supported. Cannot confirm server version. MySQL server handshake packet is broken. MySQL server does not support SSL. ldap_ExtendedResponse_parse failed STARTTLS failed, LDAP Result Code: %i drop connection and then reconnect ERROR PROCESSING COMMAND. REST OF LINE IGNORED: %s UNRECOGNISED COMMAND (IGNORED): %s BAD ARGUMENT (COMMAND IGNORED): %s Error: client did not send PSK identity PSK warning: client identity not what we expected (got '%s' expected '%s') cert_status: Cannot open OCSP response file cert_status: Error reading OCSP response cert_status: can't parse AIA URL cert_status: no AIA and no default responder URL cert_status: Can't retrieve issuer certificate. cert_status: error querying responder cert_status: ocsp response sent: ALPN protocols advertised by the client: 0kl0lpljk:(X#ғtXԑÑ4 8`HؐȐ(s`.ʌn&ދNƊq |l\K7#הǔo_̏Žϕߕ׈puVB.$~ 0܅ȅ4 ?/tEo`+?hGoT' Ciphers supported in s_server binary --- Ciphers common between both SSL end points: no client certificate available HTTP/1.0 200 ok Content-type: text/plain Error opening '%s' mode='%s' Warning: sendfile requested but KTLS is not available '%s' is an invalid file name Out of memory adding to external cache Unexpected session encoding length New session added to external cache %s: -port argument malformed or ambiguous %s: -accept argument malformed or ambiguous verify depth is %d, must return a certificate Error parsing -status_url argument Invalid value for max_early_data Invalid value for recv_max_early_data Can't use -HTTP, -www or -WWW with DTLS Can only use -listen with DTLS Can only use --stateless with TLS Can't use -early_data in combination with -rev Warning: -zerocopy_sendfile depends on -sendfile, enabling -sendfile now. Warning: -sendfile depends on -ktls, enabling -ktls now. Can't use -sendfile without -WWW or -HTTP server certificate private keysecond server certificate private keysecond certificate private keysecond server certificate chainwarning: id_prefix is too long, only one new session will be possible Setting secondary ctx parameters Using default temp DH parameters Error setting temp DH parameters PSK key given, setting server callback PSK warning: there is NO identity hint in TLSv1.3 error setting PSK identity hint to context error setting session id context Failed to initialize SRP verifier file Cannot initialize SRP verifier file "%s":ret=%d Error compressing certs on ctx Error compressing certs on ctx2 assertion failed: (family == AF_UNSPEC || family == BIO_ADDRINFO_family(res)) && (type == 0 || type == BIO_ADDRINFO_socktype(res)) && (protocol == 0 || protocol == BIO_ADDRINFO_protocol(res))unable to get certificate from '%s' unable to get private key from '%s' Private key does not match the certificate public key Collecting connection statistics for %d seconds %d connections in %.2fs; %.2f connections/user sec, bytes read %ld %d connections in %ld real seconds, %ld bytes read per connection Now timing with session id reuse.0 connections in %ld real seconds Either -skeymgmt -or -cipher option should be specified Error creating opaque key for skeymgmt %s An opaque key identified by %s is created Key generation is the only supported operation as of now %s: Cannot use -%s together with -%s %s: Must have -signer before -inkey No operation (-encrypt|-sign|...) specified Error allocating PKCS7 object Bad input format for PKCS#7 file Error creating PKCS#7 structure Error decrypting PKCS#7 structure Bad output format for PKCS#7 file Couldn't set input text length Couldn't insert AAD when encrypting Couldn't set cipher text length Couldn't insert AAD when decrypting SIG verify failure at count %d %4ld session cache hits %4ld session cache misses %4ld session cache timeouts %4ld callback cache hits server rev bufferCONNECTION FAILURE LOOKUP renego during accept LOOKUP renego during read CONNECTION CLOSED CLOSE(NONE)Client certificate Client raw public key Shared ciphers:%s CIPHER is %s NEXTPROTO is Reused session-id Renegotiation is DISABLED server bufferError reading early data Early data received: No early data received End of early data shutdown accept socket SSL_do_handshake -> %d Failed to initiate requestLOOKUP renego during write Write BLOCK (Async) Write BLOCK ERROR - memory ERROR - unable to connect LOOKUP during accept %s DELAY verify error:%s Read BLOCK (Async) Read BLOCK shutting down SSL server www bufferGET GET /stats GET /renegcertSSL_renegotiate -> %d SSL_do_handshake() Retval %d
<>&%-11s:%-25s                           
GET /'%s' contains '..' or ':' '%s' is an invalid path '%s' is a directory FILE:%s .html.php.htmError fstat '%s' Error SSL_sendfile '%s' KTLS SENDFILE '%s' OK rwrite W BLOCK GET /renegget sessionError encoding session get session bufferLookup session: cache hit Lookup session: cache miss server2.pemserver.pemCan't use -rev with DTLS Can only use -tfo with TLS server certificate chainsecond server certificateerror setting 'id_prefix' id_prefix '%s' set. Setting temp DH parameters Compressing certificates Listening for TFO localhost:4433%s: verify depth is %d %s: -www option is too long SSL_CIPHERUnable to get connection startingunable to load SSL_SESSION Context too long Error setting id context No certificate present unable to write SSL_SESSION unable to write X509 Provider: %s Key management: %s (invalid operation)Error reading S/MIME message apps/smime.cmdc2whirlpoolripemd160Error finalizing cipher loop Failed to set iv length Failed to set tag length Failed to set key and iv Failed to encrypt the data Failed to set iv Failed to set tag Failed to decrypt the data RSA sign failure ECDSA sign failure sig sign loopSIG sign failure at count %d apps/speed.cRSA verify failure ECDSA verify failure RSA encrypt failure RSA decrypt failure EdDSA sign init failure EdDSA sign failure EdDSA verify init failure EdDSA verify failure XXX o7;7d5|55\73834686X666057A54555R4f4z4444443)1=1M1a1u111111122&2:2N2^2r222222222343G3Z33U5++++++++,,",5,I,,,,- -/->-M-\-p-----..+.@.U.o.....///2/F/V/j/~////D0W0u0000 1////00$0401******>X=(@@?????x?`?H?8?(??(>8>?>>>>x>h>X>H>GGHJG JJIIII0HLLLLL4MMLDMSXR`UUUUUXXXXXxXhXXX8Y(YHYXRR8UHUYV@X(XXWWhWPWVVVVhVPV@V0VVRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRQ|TlTTTRR@ @GET %s HTTP/1.0 Lets print some clear text  Invalid cipher! +R:%d:%s:%f %d %s ops in %.2fs %s error! Failure in the job Failure in the select EC params init failure. EC key generation failure. +DT:%s:%d:%d +DTP:%d:%s:%s:%d +DTP:%s:%s:%d Doing %s %s ops for %ds: rsa512ffdh2048ecdsap224ecdhp224+R1:%ld:%d:%.2f +R2:%ld:%d:%.2f +R3:%ld:%d:%.2f +R4:%ld:%d:%.2f +R5:%ld:%u:%.2f +R6:%ld:%u:%.2f +R7:%ld:%u:%.2f +R8:%ld:%u:%.2f +R9:%ld:%d:%.2f +R10:%ld:%u:%s:%.2f +R11:%ld:%u:%s:%.2f +R14:%ld:%d:%.2f +R15:%ld:%s:%.2f +R16:%ld:%s:%.2f +R17:%ld:%s:%.2f +R18:%ld:%s:%.2f +R19:%ld:%s:%.2f +R20:%ld:%s:%.2f :%d%7d bytes:%.2f %11.2f %s: %s is an unknown digest %s: %s is an unknown cipher %s: multi argument too large %s: too many async_jobs %s: Maximum offset is %d ECP-256ECP-384ECP-521dsa1024dsa2048ED25519ED448ECDSASIPHASHPOLY1305CMACshaopensslffdhaescamelliaecdsaecdheddsaed25519ed448kmac%s: Unknown algorithm %s %s is not an AEAD cipher array of loopargsError: buffer size too large ECDH secret aECDH secret bFFDH secret aFFDH secret bfd buffer for do_multipipe failure Forked child %d dup failed fdopen failure with 0x%x Got: %s from %d +F:+F2:+F3:+F4:+F5:+F6:+F8:+F9:+F10:+H:Child exited with %d GMACHMAC namehmac(%s)aes-128-gcmmultiblock input buffermultiblock output bufferevp_cipher keyfailed to set cipher key failed to set AEAD key failed to get cipher name error setting random bytes Error performing cipher op +H+F:%d:%stype %-24s %11.2fk EVP_CIPHER_CTX_new failure Couldn't init the context Failed to set the key Failed to get the tag CMAC namecmac(%s)KMAC-128KMAC-256privECDH key generation failure. ECDH computation failure. EdDSA failure. FFDH key generation failure. FFDH computation failure. rsa%u%sX25519X448RSASVEDHKEMencaps resultencaps secretEncaps error for %s. KEM decaps secretDecaps error for %s. encapsdecapsSigning error for %s. Verify error for %s. Verify 2 error for %s. signsoptions: %s type +F:%u:%s%-13s+F2:%u:%u:%f:%f:%f:%f +F3:%u:%u:%f:%f +F4:%u:%u:%f:%f +F5:%u:%u:%f:%f %30sop op/s +F6:%u:%u:%s:%f:%f +F8:%u:%u:%f:%f %23sop op/s %4u bits ffdh %8.4fs %8.1f +F9:%u:%f:%f:%f +F10:%u:%f:%f:%f rsa decryptrsa encryptrsa verifyrsa signffdh3072ffdh4096ffdh6144ffdh8192Ed25519Ed448nistp224nistp256nistp384nistp521brainpoolP256r1brainpoolP256t1brainpoolP384r1brainpoolP384t1brainpoolP512r1brainpoolP512t1hmac(sha256)blowfishghashkmac128kmac256ecdhp256ecdhp384ecdhp521ecdhbrp256r1ecdhbrp256t1ecdhbrp384r1ecdhbrp384t1ecdhbrp512r1ecdhbrp512t1ecdhx25519ecdhx448ecdsap256ecdsap384ecdsap521ecdsabrp256r1ecdsabrp256t1ecdsabrp384r1ecdsabrp384t1ecdsabrp512r1ecdsabrp512t1ripemdcast5rsa1024rsa2048rsa3072rsa4096rsa7680rsa15360 Requested encryption length not a multiple of block size for %s! Too many fds in ASYNC_WAIT_CTX Error: max_fd (%d) must be smaller than FD_SETSIZE (%d). Decrease the value of async_jobs WARNING: the error queue contains previous unhandled errors. Unhandled error in the error queue during EC key setup. Doing %s ops for %ds on %d size blocks: Doing %u bits %s %s ops for %ds: %ld %u bits private RSA sign ops in %.2fs %ld %u bits public RSA verify ops in %.2fs %ld %u bits public RSA encrypt ops in %.2fs %ld %u bits private RSA decrypt ops in %.2fs %ld %u bits DSA sign ops in %.2fs %ld %u bits DSA verify ops in %.2fs %ld %u bits ECDSA sign ops in %.2fs %ld %u bits ECDSA verify ops in %.2fs %ld %u-bits ECDH ops in %.2fs %ld %u bits %s sign ops in %.2fs %ld %u bits %s verify ops in %.2fs %ld %u-bits FFDH ops in %.2fs %ld %s KEM keygen ops in %.2fs %ld %s KEM encaps ops in %.2fs %ld %s KEM decaps ops in %.2fs %ld %s signature keygen ops in %.2fs %ld %s signature sign ops in %.2fs %ld %s signature verify ops in %.2fs %s: -evp option cannot be used more than once %s: %s is an unknown cipher or digest %s: async_jobs specified but async not supported Too many KEMs registered. Change MAX_KEM_NUM. Too many signatures registered. Change MAX_SIG_NUM. -aead can be used only with an AEAD cipher -mb can be used only with a multi-block capable cipher %s is not a multi-block capable Async mode is not supported with -mbError creating the ASYNC job pool Error creating the ASYNC_WAIT_CTX Don't understand line '%s' from child %d Unknown type '%s' from child %d Waitng for child failed with 0x%x Child terminated by signal %d You have chosen to measure elapsed time instead of user CPU time. failed to allocate cipher context failed to initialise cipher context Impossible negative key length: %d failed to generate random cipher key The 'numbers' are in 1000s of bytes per second processed. Failed to to encrypt the data Failed finalize the encryption Failed initializing the context Requested CMAC cipher with unsupported key length. ECDH computations don't match. EdDSA verify failure. No EdDSA verify will be done. Error while initialising EVP_PKEY (out of memory?). Error while allocating EVP_PKEY_CTX. Error while initialising EVP_PKEY_CTX. Error setting DH key size for keygen. FFDH derivation context init failure. Assigning peer key for derivation failed. Checking size of shared secret failed. Assertion failure: shared secret too large. Shared secret derive failure. FFDH computations don't match. Error initializing keygen ctx for %s. Error while generating KEM EVP_PKEY. Error while initializing encaps data structs for %s. MemAlloc error in encaps for %s. Error while initializing decaps data structs for %s. MemAlloc failure in decaps for %s. Error initializing classic keygen ctx for %s. Error while generating signature EVP_PKEY for %s. Error while initializing signing ctx for %s. Error while initializing signing data structs for %s. Error while initializing padding for %s. Error while obtaining signature buffer length for %s. MemAlloc error in sign for %s. Error while initializing verify ctx for %s. Error while initializing verify data structs for %s. The 'numbers' are in 1000s of bytes per second processed.failed to get name of cipher '%s' %19ssign verify encrypt decrypt sign/s verify/s encr./s decr./s rsa %5u bits %8.6fs %8.6fs %8.6fs %8.6fs %8.1f %8.1f %8.1f %8.1f %18ssign verify sign/s verify/s dsa %4u bits %8.6fs %8.6fs %8.1f %8.1f %30ssign verify sign/s verify/s %4u bits ecdsa (%s) %8.4fs %8.4fs %8.1f %8.1f %4u bits ecdh (%s) %8.4fs %8.1f %4u bits EdDSA (%s) %8.4fs %8.4fs %8.1f %8.1f %31skeygen encaps decaps keygens/s encaps/s decaps/s %27s %8.6fs %8.6fs %8.6fs %9.1f %9.1f %9.1f %31skeygen signs verify keygens/s sign/s verify/s RSA decrypt setup failure. No RSA decrypt will be done. RSA encrypt setup failure. No RSA encrypt will be done. RSA verify setup failure. No RSA verify will be done. RSA sign setup failure. No RSA sign will be done. DSA verify setup failure. No DSA verify will be done. DSA sign setup failure. No DSA sign will be done. ECDSA verify setup failure. No ECDSA verify will be done. ECDSA sign setup failure. No ECDSA sign will be done. EdDSA sign failure. No EdDSA sign will be done. {py@}0!|||y^||{{{{ apps/lib/app_provider.cRANDFILECan't load %s into RNG Can't duplicate %s apps/lib/app_x509.chexdistidpass:env:No environment variable %s file:Can't open file %s Can't open BIO for stdin %s: Can't load %s: Error on line %ld of config file "%s" config inputoid_sectiondigest bufferapps/ts.cOut of memory loadinginput-typeInternal error trying to loadError readingCould not find from %s of %shttps://http://Unable to load %s from %s %s: OK Chain: depth=%d: (untrusted)CRL via CDPcopycopyallError loading file %s Error loading directory %s Error loading store URI %s File name too long %s.%sTrueFalseRequire explicit Policy: %s AuthorityUser[CRL path] NPN buffersubjectKeyIdentifierkeyid, issuerauthorityKeyIdentifierHARNESS_OSSL_PREFIXabappending(doing something)Can't open %s, %s Can't open "%s" for %s, %s Couldn't open file or uri %s %d: %s: %s %d: %s !!! Unknown code Total found: %d %s: criterion already given. %s: subject already given. %s: issuer already given. %s: alias already given. apps/storeutl.cURIMD5Error setting public key Error signing SPKAC apps/spkac.cSPKAC=%s Can't find SPKAC called "%s" Error loading SPKAC Signature OK Signature Failure Error getting password. cannot convert %s to OID nonce buffercould not create nonce Verification: invalid digest string extra untrusted certsFAILEDcould not create query Response has been generated. Response is not generated. calling fstat(%s)%s.attrnew DBNeed at least one user. default_srpDatabase initialised Default g and NStarting user processing Processing user "%s" List all users user "%s" reactivated. row pointersfailed to update srpvfile Password for user "%s" ok. user "%s" revoked. t User procession done. Trying to update srpvfile. Temporary srpvfile created. srpvfile updated. User errors %d. (undefined)P12TEXTNSSUnable to load %s Error reading mem buffer allocate async fdstodayParameter %s '%s' asymmetricGenerating %s key with %d bits %s: Error generating %s key %-15s %s other CRLsWarningstart dateend date NOTInvalid date format: %s explicitly set public keycertificate request inputserial# bufferapps/x509.cSHA1serial= Certificate purposes: %s%s : Yes (WARNING code=%d) No Yes CAnotBefore=notAfter=Unknown digest No extensions in certificate Invalid extension names: %s Certificate will expire Certificate will not expire Unable to write certificate b64msblobnsshttppvkesc_2253esc_2254esc_ctrlesc_msbuse_quoteignore_typeshow_typedump_alldump_nostrdump_dersep_comma_plussep_comma_plus_spacesep_semi_plus_spacesep_multilinedn_revnofnamesnamelnamespace_eqdump_unknownRFC2253onelineTypical uses: [-text] [-engine id]`0pX@(P(77HxIAIA?D?>$>?FDhGGGGhIXIGHEHEHEIHH8HGG@LKMM MNNpNPN8N NNMM LMYT[p[`[ZYpZXZ@Z0Z[[[[\p\YX\@\(\\[Y[ZZZZp|nqq rqrpppprrlrTr4r ڃ΃ВxT KĢԡ$ġ4ḑܧ $$>><<<, ???, warning, fatal, ChangeCipherSpec, Alert, RecordHeader, InnerContent, ApplicationData, Handshake, Unknown (content_type=%d)%s %s%s [length %04lx]%s%s %02xdepth=%d verify error:num=%d:%s issuer= verify return:%d gost2001gost2012_256gost2012_512server nameSSL_connectSSL_acceptundefinedreadwriteSSL3 alert %s:%s:%s %s:failed in %s %s:error in %s memory full Failed getting peer address apps/lib/s_cb.cassertion failed: length != 0cookie generate bufferNOT OKNOT OK %s: %s Suite B: not tested prepend certSecurity callback: Version=%s%s=Public key missing%s, bits=%d digest=%s, algorithm=%s scheme=unknown(0x%04x), security bits=%d scheme=%sSRP parameters: N= g=SRP param N and g rejected. SRP username = "%s" User %s doesn't exist Shared Requested Signature Algorithms: rsa_pss_pss_sha256rsa_pss_pss_sha384rsa_pss_pss_sha512ecdsa_brainpoolP256r1_sha256ecdsa_brainpoolP384r1_sha384ecdsa_brainpoolP512r1_sha512+%s+0x%02X%s: %s: a hexadecimal0Xan octalautoEnabling auto ENGINE support dynamicSO_PATHLOADInvalid engine "%s" SET_USER_INTERFACECannot use engine "%s" Engine "%s" set. apps/lib/engine.cConnection: keep-alive sending response header: %s{ }apps/lib/opt.c%s: Bad format "%s" B64BASE64p12PKCS12%s XTS ciphers not supported assertion failed: vpm != NULL%s: Invalid Policy %s %s: Invalid purpose %s %s: Invalid verify name %s %s: Option -%s needs a value %s: Not a directory: %s %s: Unknown option: -%s %s: Missing argument: %s %s: Extra option: "%s" (No additional info)-*Usage: %s [options] Valid options are: Parameters: %s %s error setting certificate error setting private key Missing filename Server Certificateserver keyserver chain%s: Error adding xcert %s: Key already specified %s: Chain already specified signed the peermatched the TAmatched the EEVerification: OK Verified peername: %s Verification error: %s TLSA hex data buffer0123456789abcdefDANE TLSA %d %d %d %s%s %s certificate at depth %d Error finishing context Error writing keylog file %s %s:%s [%s]:%sACCEPTunknown:error PID=%d*:%sInvalid verbosity level %derror setting up accept BIOerror printing ACCEPT stringapps/lib/apps_ui.cUser interface error aborted! SRP password bufferSRP userapps/lib/tlssrp_depr.cLOOKUP done %s LOOKUP not successful %s [%s]:salt bufferrounds=%u%s %s unknown typeintegerUTF8 encoded stringoctet stringunsigned pointer to a pointer to an %*s%s: [%d] (arbitrary size) (max %zu bytes large)%*s %s [Success]: %s [Failure]: %s Unable to rename %s to %s %s.attr.%sUnable to open '%s' unique_subject = %s invalid revocation date %s missing hold instruction invalid object identifier %s missing compromised time invalid compromised time %s invalid reason code %s %s: Out of memory ExpiredRevokedValidundefPRINTABLE:'T61STRING:'IA5STRING:'UNIVERSALSTRING:'ASN.1 %2d:'\0x%02X^%coptionalsuppliedmatchType :%s Was revoked on:%s Expires on :%s Serial Number :%s File name :%s Subject Name :%s Certificate Details: (%ld days)Sign the certificate? [y/n]:row expdaterow spacecertificate requestError unpacking public key Negotiated TLS1.3 group: %s Peer Temp Key: RSA, %d bits DH, %d bits ECDH, %s, %d bits groups to printSupported groups: Shared groups: ansiX962_compressed_primeansiX962_compressed_char2unknown(%d)Protocol version: %s assertion failed: num == 2Client cipher list: Ciphersuite: %s Peer certificate: Hash used: %s Signature type: %s Peer used raw public key Client Certificate Types: UNKNOWN (%d),Peer signing digest: %s Peer signature type: %s HTTP/1.0 %d %s GET or cannot get port listening onawaiting next request ...request line read errorBad Request HTTP/1.error reading HTTP headerConnectionkeep-aliveclosePOST received request header:%s "%s" %d = "%s" , , %s, %s, Iteration %ld, PRF %s, Iteration %ldKey bag Bag AttributesKey AttributesShrouded Keybag: Certificate bag Secret bag Bag Type: Bag Value: Safe Contents bag RSA signRSA fixed DHDSS fixed DHECDSA signRSA fixed ECDHECDSA fixed ECDHGOST01 SignGOST12 SignSHA224SHA384SHA512anonymousrsa_pkcs1_sha1ecdsa_sha1rsa_pkcs1_sha256ecdsa_secp256r1_sha256rsa_pkcs1_sha384ecdsa_secp384r1_sha384rsa_pkcs1_sha512ecdsa_secp521r1_sha512rsa_pss_rsae_sha256rsa_pss_rsae_sha384rsa_pss_rsae_sha512gostr34102001gostr34102012_256gostr34102012_512Supported CiphersuiteShared CiphersuiteCheck CiphersuiteTemp DH key bitsSupported CurveShared CurveCheck CurveSupported Signature AlgorithmShared Signature AlgorithmCheck Signature AlgorithmSignature Algorithm maskCertificate chain EE keyCertificate chain CA keyPeer Chain EE keyPeer Chain CA keyCertificate chain CA digestPeer chain CA digestSSL compressionSession ticketOverall ValiditySign with EE keyEE signatureCA signatureEE key parametersCA key parametersExplicitly sign with EE keyIssuer NameCertificate Typemax fragment lengthclient certificate URLtrusted CA keystruncated HMACstatus requestuser mappingclient authzserver authzsupported_groupsEC point formatsSRPuse SRTPsession ticketrenegotiation infosigned certificate timestampsclient cert typeserver cert typeTLS paddingnext protocolencrypt-then-macextended master secretcompress certificatekey sharesupported versionspsk kex modescertificate authoritiespost handshake auth, HelloRequest, ClientHello, ServerHello, HelloVerifyRequest, NewSessionTicket, EndOfEarlyData, EncryptedExtensions, Certificate, ServerKeyExchange, CertificateRequest, ServerHelloDone, CertificateVerify, ClientKeyExchange, Finished, CertificateUrl, CertificateStatus, SupplementalData, KeyUpdate, CompressedCertificate, NextProto, MessageHash close_notify end_of_early_data unexpected_message bad_record_mac decryption_failed record_overflow decompression_failure handshake_failure bad_certificate unsupported_certificate certificate_revoked certificate_expired certificate_unknown illegal_parameter unknown_ca access_denied decode_error decrypt_error export_restriction protocol_version insufficient_security internal_error inappropriate_fallback user_canceled no_renegotiation missing_extension unsupported_extension certificate_unobtainable unrecognized_name bad_certificate_hash_value unknown_psk_identity certificate_requiredSSL 3.0TLS 1.1TLS 1.2TLS 1.3DTLS 1.0DTLS 1.0 (bad) (ȲвزhhhhhhhhXhhXhhhhhhhhhhhhhhhhhhhhhhhhhhhh;Ӽb>N>Nx`H0@( ( X(xX8xX8xX8PPP@PPP [L $$..-$.---t,4r$trtsqrounds=.+* FKeylog callback is invoked without valid file! Not TLS data or unknown version (version=%d, content_type=%d)TLS %s extension "%s" (id=%d), len=%d read from %p [%p] (%zu bytes => %zu (0x%zX)) read from %p [%p] (%zu bytes => %d) write to %p [%p] (%zu bytes => %zu (0x%zX)) write to %p [%p] (%zu bytes => %d) error setting random cookie secret Error calculating HMAC-SHA1 of buffer with secret Checking cert chain %d: Subject: s_cb.c:security_callback_debug op=0x%xSRP param N and g are not known params, going to check deeper. SRP parameters set: username = "%s" info="%s" %s: Can't parse "%s" as %s number %s: Can't parse "%s" as a number No engine specified for loading %s No engine key id specified for loading %s HTTP/1.0 200 OK %sContent-type: %s Content-Length: %d sending response, 1st line: %.*sassertion failed: unknown_name != NULLassertion failed: unknown == NULLassertion failed: unknown->valtype == 0 || unknown->valtype == '-'%s: AEAD ciphers not supported assertion failed: opt > OPT_V__FIRSTassertion failed: opt < OPT_V__LAST%s: Internal error adding Policy %s %s: Internal error setting purpose %s %s: Option -%s does not take a value %s: Non-positive number "%s" for option -%s %s: Negative number "%s" for option -%s %s: Invalid format "%s" for option -%s %s: Multiple %s or unknown options: -%s and -%s %s: Extra argument after %s: "%s" %s: Extra (unknown) options: "%s" "%s" error setting certificate chain error building certificate chain %s: Error initialising xcert %s: %zu-byte buffer too large to hexencode matched the peer raw public key Call to SSL_CONF_cmd(%s, %s) failed # SSL/TLS secrets log file, generated by OpenSSL --- No %s certificate CA names sent --- Acceptable %s certificate CA names Secure Renegotiation IS%s supported This TLS version forbids renegotiation. error setting accept on port %sCould not allocate %d bytes for %s Missing newline at end of input String too short, must be at least %d bytes long String too long, must be at most %d bytes long Warning: truncating password to %u characters [Error]: internal stack error [Error]: command name too long Error creating random number to store in %s Unable to load number from %s Error converting number from bin to BIGNUM %s: %s name is expected to be in the format /type0=value0/type1=value1/type2=... where characters may be escaped by \. This name is not in that format: '%s' %s: Error copying %s name input %s: Missing '=' after RDN type string '%s' in %s name string %s: Escape character at end of %s name string %s warning: Skipping unknown %s name attribute "%s" %s hint: a '+' in a value string needs be escaped using '\' else a new member of a multi-valued RDN is expected %s warning: No value provided for %s name attribute "%s", skipped %s: Error adding %s name attribute "/%s=%s" invalid type, Database error The Subject's Distinguished Name is as follows emailAddress type needs to be of type IA5STRING The string contains characters that are illegal for the ASN.1 type %s:unknown object type in 'policy' configuration The %s field needed to be supplied and was missing The mandatory %s field was missing The %s field does not exist in the CA certificate, the 'policy' is misconfigured The %s field is different between CA certificate (%s) and the request (%s) %s:invalid type in 'policy' configuration Everything appears to be ok, creating and signing the certificate Extra configuration file found Error adding certificate extensions from extfile section %s Successfully added extensions from file. Error adding certificate extensions from config section %s Successfully added extensions from config ERROR: adding extensions from request The subject name appears to be ok, checking database for clashes ERROR:There is already a certificate for %s ERROR:Serial number %s has already been issued, check the database/serial_file for corruption Certificate is to be certified until CERTIFICATE WILL NOT BE CERTIFIED: I/O error CERTIFICATE WILL NOT BE CERTIFIED The matching entry has the following details Certificate request and CA private key do not match Signature verification problems... Signature did not match the certificate request Supported Elliptic Curve Point Formats: No peer certificate or raw public key awaiting new connection on port %s ...cannot parse HTTP header: missing end of lineinvalid %s -- URL does not begin with '/': %sinvalid %s -- bad HTTP/version string: %sinvalid %s request -- bad URL encoding: %scould not allocate base64 bio with size = %dHTTP request does not begin with %sPOST: %serror parsing HTTP header: missing end of lineerror parsing HTTP header: missing ':'error parsing DER-encoded request contentout of memory allocating %zu bytesreceived request, 1st line: %s, Salt length: %d, Cost(N): %ld, Block size(r): %ld, Parallelism(p): %ldWarning unsupported bag type: application layer protocol negotiation bad_certificate_status_response ;T``1d5p1R8p99`:(;@<ABhCEF4FKL8 PpPZHce0` L0<pD@$лp`0PP DP<%%p&P@&p& X''`((D)@l) ) *p!P*!*V +cp+`i+`j+pmx,@q,t8-`.`L...\/P/00055 586x6 6P6@D777 T8P 8 8`$9p99 :&l:0':':(;*p;P+;+;0,</l<`/</<2D=2l=p3=6>6T>7>`:>:?@;d?P=?=?0><@@@@@@ AAC`A0DADAEAEHBGBpHBHBH$CIpCKCLCLHDND0ODO ERETE UFpUHFVF@|F }`GG@,H@HPH`HpHHH@DI0I`IpIIJ$JО@JСJ$KpPKKTL L(MMpMMHN` OP XOPOO0DPPIHR OR`Q S\S \S0\S@\SP\Sp\S^PT^dT^xT jTsUv\UxUxUpy,VPztV{V|BBB E(A0D8G` 8M0A(B BBBK l 8A0A(B BBBJ ! 8I0H(B BBBE \$@BEB B(D0D8D 8A0A(B BBBE rJTC\`DBBB B(D0D8G  8C0A(B BBBD JYAFNFGB J(A0K8Gt 8D0A(B BBBC MEBZkGDEBAoONBLONBKEBZBBEBAo8HXBBB H(J` (A BBBD \ Z FBE I(D0C8K7 8D0A(B BBBD 9EOBLXbwFEB I(D0C8N 8D0A(B BBBC \jFEI H(A0C8K 8D0A(B BBBF JQAH LqFHH D(A0] (D BBBF D(A EBB\T qFEE D(A0Y8R@VHIPO0 (D BBBF D (A EBBA X s1FEB B(A0A8DVUHK 8D0A(B BBBA ^UOHZIVPTIIeOHKtUAFgV UOMK eVPTIVUHKb UOHE dOUHKwVUHKIVUHKxVUHKIVUHKbVUHKNCHLIOAO[AOUHKhVUHKqVUHKNOUOKbOUOK\OUORYOUHKcOUHKIVUHKxOUOKNOUOKMUHIVQOAY_MUMOGQOF\p KOAE b JOAE _MUHIMKVAR GAFE OUHKMUHIK JOAE BMUIIXMUIIDQOBRFMUHPQMUIIp JOBE AMUII JOAE b GRBE WUIAK_MUHIM JOFE NPRNPTMUHIFPRHPwVUHKFVUHKZOUHK[OUHKNOUHKeVUKIoPRMISVUHK&H0&FHI o BBF R EBG D(V0U8H@K |&'H^L&0FBE I(D0C8N 8D0A(B BBBH <&FDG s NDJ D ABI aCBL$' FBE E(D0H8Q 8D0A(B BBBG t'P#KT`'hBBE A(D0g (D BBBA X (D BBBF U (D BBBA 8'FAD Z ABH T JBH L,(xBFE D(A0 (C BBBD A (F BBBC |((FBE B(D0A8GI_B 8A0A(B BBBI IcAmBaAH)TBEH E(A0A8DPa 8A0A(B BBBK 0L)FAD Jw  AABH L)h FBE E(A0A8Gl 8A0A(B BBBG H)4HFBB B(A0H8J\ 8D0A(B BBBH \*8LFEB I(D0C8K 8D0A(B BBBI cLQAH|*(FEB I(A0H8LPn 8D0A(B BBBJ L*FII I(D0H8K 8D0A(B BBBE $+|1EAG WDD$@+AEAG gDDHh+FII E(A0@ (B BBBJ S(B BBBd+BBB L(A0A8D@ 8D0A(B BBBE  8J0A(B BBBJ ,x]EX S N$<,AEAG gDDHd,FII E(A0@ (B BBBJ S(B BBBd,$BBB L(A0A8D@ 8D0A(B BBBE  8J0A(B BBBJ $-AEAG gDDH@-FII E(A0C (B BBBG D(B BBB`-BIB B(A0A8D@ 8D0A(B BBBE 8J0A(B BBB$-DAEAG gDDH.lFII E(A0@ (B BBBJ S(B BBB`d.BIB B(A0A8D@ 8D0A(B BBBE 8J0A(B BBB4.kFAD f ABD eDEH/$FII E(A0@ (B BBBJ S(B BBBLL/hLBIB B(A0A8Q  8A0A(B BBBH $/hAEAG gDDH/FII E(A0@ (B BBBJ S(B BBB`0BIB B(A0A8DP 8D0A(B BBBE ~8J0A(B BBB$t0AEAG gDDH0FII E(A0@ (B BBBJ S(B BBB`0BIB B(A0A8DP 8D0A(B BBBE ~8J0A(B BBB$L1AEAG gDDHt1FII E(A0@ (B BBBJ S(B BBBH1BII I(A0A8FP 8D0A(B BBBH $ 2xAEAG gDDH42FII E(A0C (B BBBG D(B BBB$2AEAG gDDH2 FII E(A0@ (B BBBJ S(B BBB`2P=BII I(A0A8FP 8A0A(B BBBK K 8J0A(B BBBE 4X3,EKD W FAF k FAF 3(H_$3AEAG gDDH3FII E(A0@ (B BBBJ S(B BBB`4=BII I(A0A8FP 8A0A(B BBBK K 8J0A(B BBBE $4AEAG gDDH4 FII E(A0@ (B BBBJ S(B BBB`4P=BII I(A0A8FP 8A0A(B BBBK K 8J0A(B BBBE $X5, AEAG gDDH5T FII E(A0@ (B BBBJ S(B BBB`5 =BII I(A0A8FP 8A0A(B BBBK K 8J0A(B BBBE d06t BBB B(D0A8F` 8A0A(B BBBK + 8J0A(B BBBJ $6AEAG gDD06FFDG M ABG SDB`6 kBIB B(A0A8D@ 8D0A(B BBBH K8J0A(B BBBLX7,U%FBE E(H0H8Qf 8D0A(B BBBJ `7<5FEE E(G0G8F@s 8F0A(B BBBE F 8C0A(B BBBF \ 85 FBB I(D0A8D 8D0A(B BBBA LQAhl8?xFBE B(A0C8D~ 8A0A(B BBBA $ISAH IU `8 HFBE A(D0o (D BBBE X (D BBBF U (D BBBA <9HP9Hd9Hx9H9HL9HFBB I(D0A8D 8A0A(B BBBE H9NFEE B(D0H8NP 8D0A(B BBBB <:Q#P:Qd:Q@x:QCBBB E(A0Dp 0D(B BBBG :S :SYBH:TFBB B(A0H8GpS 8D0A(B BBBD 8;<FEI H(A0C8K` 8D0A(B BBBE >H> oBBM E(A0D8J 8D0A(B BBBK >0FBB B(A0A8G L" 8D0A(B BBBF 7 "G"^"B""G"^"A""T"I"B"S" "G"h"A""B"["A""M"B"G"["H?LFEE B(D0H8N` 8D0A(B BBBC H@FIE B(H0C8Ipb 8D0A(B BBBG HP@BEE N(D0D8MP 8D0A(B BBBE P@LBBB B(A0A8G I  8A0A(B BBBF @FBE B(D0D8GHLBAIADBFAEBDQF 8D0A(B BBBF @|A8g0FBB E(D0A8G 8A0A(B BBBE IBIQy\BBBBBISXKBAN^BBBBBIQ7HGHq ]LBaO\BNZBIQYAOfB I[A0BT/FBB I(D0A8LLB0FBB E(A0H8G3 8A0A(B BBBD DC9FBA D(DG (M ABBF Q (M ABBM  (A ABBH ^ (C HBBK z (I HBBE lC8 FBB B(A0A8G- 8A0A(B BBBA CcBzVbAFDB B(A0D8DP 8D0A(B BBBI tLLFBB B(D0A8G 8D0A(B BBBG EBFNGBEbHL]FBE B(D0D8GPM 8D0A(B BBBH (LBFD KKHL\FLB G(D0O (C BBBI A(F BBB$DMoFAD ]DBTlMFEE E(D0C8GPe 8A0A(B BBBF kXS`PXAPHMPFQB B(A0A8KP 8F0A(B BBBG TNKBBA A(G L@I@@H@V@A@ (A ABBF LhN`FBB B(D0A8I 8D0A(B BBBD LN FNB B(A0A8J 8F0A(B BBBG HOLKFLI B(G0A8DP 8C0A(B BBBK 8TOPFBA A(D@ (A ABBA HOFEB B(A0A8DP 8A0A(B BBBA OCA}Oj7FBB E(H0C8G 8D0A(B BBBE HmAIHBGqOnB&NQEINcB8PTBED A(G@ (D ABBK dP V FBB B(A0A8G L@LA\ 8D0A(B BBBJ aAHA^AAAHLQ`FBE I(D0C8Kp 8D0A(B BBBG HQleKFBI H(A0C8K` 8D0A(B BBBE $Qpi;FGG `DB\ RiFBB E(A0C8G 8D0A(B BBBG FfAlR(H_RR RR$R0R<RHST$S`8SlLSx `St tSp Sl 4ShFAA v ABG GAE4SЇFHA i ABE GAE@ T(FBB A(A0D@~ 0D(A BBBG HPTԉ$FBB B(A0A8DP 8D0A(B BBBA LTFBB B(A0A8DB 8D0A(B BBBA HTFBB B(A0A8D@ 8D0A(B BBBA H8UFBB B(A0A8D@ 8D0A(B BBBA HU@FBB B(A0A8D@ 8D0A(B BBBA @UԏoFNB A(A0Dp 0D(A BBBI HVFBB H(A0l (D BBBG h(D LBBH`VFBB H(A0t (D BBBG h(D LBBHVFBB H(A0t (D BBBG h(D LBB@V FFB A(A0D` 0D(A BBBJ HFBB H(A0H8F@ 8D0A(B BBBA $cDREU F Y O WHcRIFIH B(A0A8O` 8D0A(B BBBD LDdSFHD D0b  AEBH s  ABBH ^  ABBE Pd`TFIA PS  DABF v  IHBG ^  KHBM LdWFEA D(G0L (A ABBG L (A ABBF (8e|XFLH ^ BBD HdeYdFEE D(G0f (D BBBE I(D BBB0e$YFGA G0Q  DBBB \eYFBA D(D0 (D ABBB a (D ABBF O (A DBBH DfZEAG(`fD[JFQG N BBA Hfh[BBB A(A0G I % 0D(A BBBH (f\EDD P AAA tg@] FEB B(A0A8JOYB 8D0A(B BBBK OIAV\|gi,FEE E(D0G@NHKPKXB`FhBpBxBN@T 0A(B BBBC HgxjUBBG B(A0A8DpB 8D0A(B BBBF T(hm,FEE D(G@NHJPOXB`BhBpBxBN@T (A BBBK `hdnKBBI E(G0A8DP 8M0C(B BBBO i 8C0A(B BBBA HhPoFBB B(A0 (E BBBE T(E BBBL0ioFKD F@bHJPBXB`BhBpBxFI@m  ABBF idpFEE E(D0D8G`fhNpKxBBBGGI`z 8A0A(B BBBD dhKpKxBBBBBI`H jpFED I8[@BHBPBXF`BhBpN0Y  ABBA dXj|qQFEB E(D0D8G@MHHPIXG`BhBpBxBI@ 8D0A(B BBBD TjtrFBB E(A0D8G`ThIpThA`G 8D0A(B BBBA HkFDD l FBF @CB8>FBD D(D@ (A ABBA (܄(?FBJ0I EBF 8?FBD D(D@ (A ABBA 0D@FBA D0{  DBBH HxE8FBB B(A0A8Gl 8D0A(B BBBB ąJHD D e K L\KfFBB B(A0A8J 8A0A(B BBBA L8|N*FBA A(D0x (D ABBA h (D ABBG (\OaJHG AAFDO*FAA  ABJ A FBG ] CBA 0P2FAD F0Y  AABB \0RwFBB B(D0D8D 8A0A(B BBBK DLD\UFEB A(G0] (A EBBD y (D BBBE `(D BBBHTVFEA D(F0w (F ABBH S(F ABBH<V2FHB E(A0A8GP  8A0A(B BBBK |XGE}4XFDG d CBF F ABG \܈XY FBE G(A0I (A BBBK p (A BBBI A(D LDB0<ZFGG L CBK DMBHpdZFBL E(D0D8FPr 8D0A(B BBBJ @\<FEE K(A0Lp: 0D(A BBBC $^JEP K U K IT(<^|FEE E(A0A8D@HMPWHA@m 8D0A(B BBBA (d`FKN@\ DBG (aK B 8ȊaFED D(D@m (D ABBC @@bFBB A(A0D 0D(A BBBJ 8HcFBA A(D (D ABBD pdbE L M|d,FEE E(D0D8G@ 8F0A(B BBBD ~ 8A0A(B BBBH N 8F0A(B BBBK L$pf4FBB E(D0D8J 8A0A(B BBBE Lt`zFJI E(A0A8Qd 8A0A(B BBBA dČ|FHB E(A0D8G# 8A0A(B BBBB A 8F0A(B BBBH 0,H~FDD D@  AABI `~0@tFEE A(A0J 0D(A BBBH 8|~FBB A(J (A BBBJ LFBB B(D0A8JZ 8A0A(B BBBA LDPFBB B(A0D8G  8A0A(B BBBD HFIB B(A0A8J` 8D0A(B BBBH X`FBB B(A0A8G`%hJpVhA` 8D0A(B BBBJ L<CFBB B(A0A8G 8D0A(B BBBA XFBB L(A0A8LPXM`HhHpHxGGGGAHHGGGHGGGGlP[ 8D0A(B BBBD 0(LFDD O  ABBK `\8FDB B(I0G8DPV 8K0A(B BBBL D 8A0A(B BBBA H)FDB B(A0L8DP 8A0A(B BBBI H FBB B(A0D8Dp~ 8A0A(B BBBC HX ?FBB B(G0D8Dp 8A0A(B BBBG 0FND O  ABBA Pؑ FBB B(A0A8G I! 8D0A(B BBBB (,ضgFDA XAB@XFEB A(A0DP 0A(A BBBD dFEE B(G0D8F`*hIpRhD`d 8C0A(B BBBD hJpVhA`P[80hX80(( PH@0h `xXPH@ph`8 H@XpxP H@80( \ -_ o sZ [sZ Q N([ -t  sp[  s[ [  s\  s`\ \  s]  sH] -]  s]  s^  -@^  s^ k s^ _ h_  N_  s_ @`  s`  -`  s a  spa  -a + na 0b 0 spb 4 sb @ -c Q -@c c . sc a sc -0d j s`d d d d]s@e e f se r !nf `f -| "sf f  #sHg  $sg g  %s(h  &sxh  'Nh  (Ni  )N`i -i t *si  D +sj  ,s`j  -sj  .-k  /-Pk k k  0-8l + 1sl 6 2sl D 3sm O 4shm  5sm  6sm  7s@n Z 8sn b 9sn i :so -8o  ;sXo ~ <so aZ=so 8p xp p >sp |?sp l @s0q |Aspq ~Bsq  Csr Xr | D-r - o Esr  Fs(s f Gsps  Hss Iss @t -  Bst  Ast  Dsu  Cs0u -  s`u  >u - 8 -u A sv J sPv R sv ^ sv h sw Xw t sw -w } -w  p8x  sx  -x  sy  s@y  sy  sy  -z - { sHz  Nz  sz  s {  s  sp{ ( s{ 4 s{ @ s| N sX| W s| ` s| (} h s`} t s} | s}  s~  s@~  s~  s~  N  N`  -  N .N0  Nx  sȀ  -  -( , -` < -8 O -p a - -s  sЂ  s  s  n  n  M  s  7 sD X sb { -(  -  -P  -  -  -x  - ! -Ѓ - - 9 -F c -n } -0 - -X - - -! ! - +! - 9! - G! - S -Y! -w! \ -_ -Xy -@ x -! ! -! ! sh - hn-! u -! u - u -Ѕ v - ! - ` -8 ! sh -  Bst  Ast  Dsu  Cs0u P -ol  " " &" 9" D" Y" i" ) !  w" " " " " " " " @" " " " " # # # &# 0# S - -w! \ -_ ! - 6q 5- 9# /@# 1i <Y# s# F0 z# *-p 6 > # s # - } -#  "-0 # +<h # ,< sЈ -# o s# *l s [s#  s# -$ $ s  -H "$ -x  4- 0$ - X$ s ?$ (sJ$ z$ sP b$ )sl$  p #} /sЊ $ 0< $ -$ $ -@ -F} sh ? s$ f f  s |s aZ<$ o F` $ - sȌ $ s -$ $ !-% OZ.s h 1sP % 2-% 8% 3s @% Fs$ K% Gs T% Hs c% IsH u% #s % $s؎ % %p % &p@ % 'p`  -<% -  s`u  >u -  Bst  Ast  Dsu  Cs0u P -o% -w! \ -_ % <% -% s# A 1i < 6 > & & !& p(& } p9& S& p @ \& sh c& s k&  u& sz& & -& e & & & p S - -w! \ -_ s( -͡ 1i <ݡ s# F -Xy 6 >  F K -1 & -? ! -I 6q -X e -l -  s`u  >u -  Bst  Ast  Dsu  Cs0u P -o X -w! \ -_ _ - - - -¢ s( -͡ 1i sݢ s# fH -x  s -Xy 6 >  f & -& K -: } -P k - r s -  Bst  Ast  Dsu  Cs0u S - -w! \ -_ x[ -z - s( -͡ 1i <ݡ s# F -Xy 6 >  F K -0 & -X Iw -x - -  - ! -I 6q -X -  s`u  >u -  Bst  Ast  Dsu  Cs0u P -o S -X -w! \ -_ \ -Σ s( ۣ -x  s -Xy \ - # - 6 > f f( ^ - -  pX բ - q - -F} ys- k%s K s sȌ } <T r sw ~s@ sh _ - - -  s`u  >u -  Bst  Ast  Dsu  Cs0u P -og -w! \ -_ -͡ 1i <ݡ s# F - Ť <8 -Xy 6 >  F -  Bst  Ast  Dsu  Cs0u -w! \ -_ k%-Τ -͡ 1i < s# Fp |< f F -Xy 6 >  F # s K - i -7 e - H s@ _ - -P d]-^ y% -n % - & - -  - ѥ -x إ < -$ / < :8 -h - - -  Bst  Ast  Dsu  Cs0u S - \ -_ -w! 1i <ݡ 6 > o F<@ - _%- S%-$ y-> k% -K a -h -x < |s - -8 -p - æ - ٦ - -  -8  -& -; s# c`  c Q /FY (-m (- )- #- *- -0 -§ ߧ <s` :s ;s  Fs  >s v} Hs8 f Gf` Ps( -  Bst  Ast  Dsu  Cs0u -  s`u  >u - s 0 C<6 J . _ - | Os0 R K-^ u L- M- N-Ũ ި -p -F} Es Bs Ť 0< " -P ( -1 D - L - S !- ^ "- n --( .-h Is Js - s t 7<H ש &- '- %- -  - " -P  -x 1< 2/ 3: 5-h 4- 6- -Xy $-: U =sc K - F D>| )y ?s My @s k As - & +- & 8-P H 9s Ǫ ,-ݪ -s  sЂ  s  s  n  n  M  s  7 sD X sb { -(  -  -P  -  -  -x  - ! -Ѓ - - 9 -F c -n } -0 - -X - - -! ! - +! - 9! - G! - -w! \ -_ 1i <  s  -P d &-x -  ?s s# f0 $ s( |sP d sd f E 6 >d  f d C- & 5- -P K '-p # s d s ,- e 9-d f "-e X$ /-"e z$ 0-- 1} Fs e <- e !-e  .- f %-@ } $-f -h /f 1M  8f 2s Bf 3s Mf 4s( -Uf rf sP }f #- ?$ Es b$ FsP  n f D- f s f sH $ sf f < f ;- $ < #} s8 sp ѥ @- _ A- -f c< f F@ f sp f E f s g :- -@ g 6-h g s "g 7-+g Fg s Og 8- Yg s -  s`u  >u BsЈ -  Bst  Ast  Dsu  Cs0u -w! \ -_ -Xy o  -cg } -qg բ -g Ă -g -g -g p -H C -g # -h -h \ -1h S - -w! \ -_ sЈ ! -p H s@ -Hh t < < / : -( -` - D < dh < lh -P yh - -s  sЂ  s  s  n  n  M  s  7 sD X sb { -(  -  -P  -  -  -x  - ! -Ѓ - - 9 -F c -n } -0 - -X - - -! ! - +! - 9! - G! - $ s -  Bst  Ast  Dsu  Cs0u P -oaZ -w! \ -_ o <h [s sЈ  s0 sh h <h <h /h :h D <i +i -4i Ki -Ui  s _ - -mi i -}i q <i |si i <i aZ -i 1i <ݡ -i k%- j ,j -j 2j s;j Mj -Vj 6 > K -mj -  s`u  >u -s  sЂ  s  s  n  n  M  s  7 sD X sb { -(  -  -P  -  -  -x  - ! -Ѓ - - 9 -F c -n } -0 - -X - - -! ! - +! - 9! - G! - -  Bst  Ast  Dsu  Cs0u S -j -w! \ -_ _ - sЈ -j h -j } -j j -j k sj d] sP f s s e s k # -k -͡  s -Xy 6 >d K - & -1k -  Bst  Ast  Dsu  Cs0u P -oe Lk S - -w! \ -_ ! -dk o <# *l s( sЈ -k -k k -P k - \ -k -# k <k *z s k s  s r s -  s`u  >u -  Bst  Ast  Dsu  Cs0u P -or -w! \ -_ k s sЈ -͡ 1i <ݡ |<` f f  s k sl # sl -Xy |s 6 > & -/l f -Al k%-Sl -  Bst  Ast  Dsu  Cs0u S - -w! \ -_ jl -8 ml -p ppl l p sЈ  Gp l L- l M-  o F<@ -l l sH r sl l Ksl S%-h l J- l N-m  O- -'m 8m - Hp0 Ip` @m p -  s`u  >u -  Bst  Ast  Dsu  Cs0u P -o  S - -w! \ -_ 1i <ݡ s# c` 6 >  c  s f f` sЈ -m - - o F<@ -k _%- S%-$ y-> a -h k%-K Im -Pm -hm  s s _ -  - ( -1 L - -0 sh t <H D -P - - - Ť !< 0 < -m )y s My s k s K - S - -Hh #/ "< $: %-h &- '- m - - -  s`u  >u -s  sЂ  s  s  n  n  M  s  7 sD X sb { -(  -  -P  -  -  -x  - ! -Ѓ - - 9 -F c -n } -0 - -X - - -! ! - +! - 9! - G! - -  Bst  Ast  Dsu  Cs0u P -oaZ8 -w! \ -_ m Gs` m Hs e I- l Fs -  Bst  Ast  Dsu  Cs0u -w! \ -_ m sm -͡ 1i s s# F -Xy 6 >d  f@ K -m aZ-m & -p -w! \ -_ -m js  -n >n -)n Dn -In l sp ! s u -gn u -xn u -n v -n k%p  p8 n s` -$ H s@ aZ< |< n <n <n /n :n -h - - -  Bst  Ast  Dsu  Cs0u -w! \ -_ o Ts( o @-o sЈ -)o { p` js ;o s @o - -Go -Uo -co m svo )<n /n -:n *-h - .- d -8 k% n`  n H s@ aZ< o i< o F8 o <x o (- o s |s o j<8 f fx Lx s l < o F o <X o < o f o s o <o (z gs8 o h-` p 2- D- 6q E-p 'p H- n P-( ;p Q-P ?p {-x Up 6- ap R- fp fs pp os@ }p pph <p p %F lh - p +< p !/@ p /: p ,< p "/ p 0:8 p #-p q $-p q &- /q '- ?q 3- -r (r ?>0 |` C-0r Er S-Kr hr Wpp vr p ~r q>r -)o r 1-r  b-r r cpr r Xp r Vp r Up s -'s IsAs Xs Jsas ! Kszs s L<8 k M<` s Ns - s rn s sn( t-s s un` s v- s w- s y- t z-X t e-t u ]-6t u \-Ft u [-Xt v Z-jt |t ^-t t d-x t _-t t `-t t a-t t x-t u ns u G-u .u ks ;u lsH @u |- Nu m- Eu }- Wu - iu -P -  s`u  >u -{u u -u u -u u -u u -u v - v Dn -In v - #v -(v Fv - Vv - fv - pv -@ {v -` v - _ -v v - v - v -( v -h w - w - 2 -0 ,w sh %w s э s Z s 4w s0 l sh ! s @w s Mw s Zw s iw -( w -h w - w - -s  sЂ  s  s  n  n  M  s  7 sD X sb { -(  -  -P  -  -  -x  - ! -Ѓ - - 9 -F c -n } -0 - -X - - -! ! - +! - 9! - G! - - w <w w < w <( w -H w F w F -  Bst  Ast  Dsu  Cs0u S - -w! \ -_ $sЈ w s0 o 4sp  - w - x < x -)o x s!x { p!x js 6x s(  sP ;x s Fx s ;o s -Go -Uo Qx ]p! r ^p s r _p hr `pp r ap \x -jx -co aZ <X! o Fx! o B<! o E-! |Cs" f @Ex Lx As k% p` H s@ H/n L<n P:n M-h I- Q- x d<8" x sx x sp" x -" +sx ! ,szs s -<8 *l \s" -x x D-0# y >y ,y <4y -Ry - 6q -iy ?q -p# 0 p )-y |` *-y pp Zs@ }p [ph q &-$ q '-$ o %-$ ~r b>r z -% z -z (z Vs@% &z W-% Up - ?p -x h -H o Ts% ;u Gs& Er X-`& r -r - u 8-3z u 7-xn u 6-n v 5-n |t 9-Bz Zz <-_z  >-& r ?phz t :-z t ;-z t =-t t -t .u Fs& c<z z -' Wu - iu -P u Ys z .s0' z /s`' z 1-' z 2-' z 0p( @u - -  s`u  >u -{u u -u u -u u -u u -u v - v Dn -In v - #v -(v Fv - Vv - fv - pv -@ {v -` v - _ -v v - v - v -( v -h w - w - 2 -0 ,w sh %w s э s Z s 4w s0 l sh ! s @w s Mw s Zw s iw -( w -h w - w - -s  sЂ  s  s  n  n  M  s  7 sD X sb { -(  -  -P  -  -  -x  - ! -Ѓ - - 9 -F c -n } -0 - -X - - -! ! - +! - 9! - G! - <p lh -0( p FX( q - /q -( p N< p J/( p R:( p O< p K/) p S:P) - w <w w < w <( w -H w F w F -  Bst  Ast  Dsu  Cs0u P -o{ ) -w! \ -_ y - { k% - { _%-7{ S%-O{ sЈ -͡ 1i <ݡ  s) f E) -* h{ -8* e -h*  s -Xy 6 > o{ -s{ { -* { -{ { -{ { -* { -{ -  s`u  >u -  Bst  Ast  Dsu  Cs0u -w! \ -_ x[ -{ _ - sЈ -͡ 1i sݡ s# f* -x { -|  s -Xy 6 >  f+ k -| .| -?| r s & -& K -: } -f Y| F-@+ -e| - - -¢ -  Bst  Ast  Dsu  Cs0u -w! \ -_ l sh+ sЈ s| s+ 1i <+ s# F0 k%-, -$  -| o <| [2s(,  -P, H s@ | s| K "-| | #-, | $-, c%<, f &s(- | $ s`- k !-- 0$ '- ?$ (s b$ )sP  *p- rf +s}  ,s- #} -s.  .s} .} /s`. 5} 0-. -=} |s. f f( f -Al  >X}  s/ r s  sH/ u} s/ sȌ $ s _ 1- -Xy 6 >  F } -/ ! -I 6q 3-X }} -} } -/ & -} } -0 } -} -  s`u  >u -  Bst  Ast  Dsu  Cs0u S -00 -w! \ -_ -_ } -X0 e" -0 K -} -Xy -I -  Bst  Ast  Dsu  Cs0u P -og 0 S -0 -w! \ -_ sЈ -Xy 6 > [ -} ^ -~ -  s`u  >u -  Bst  Ast  Dsu  Cs0u P -o ~ S -1 -w! \ -_ B~ p0~ Q~ pG~ -Xy ^ -X~ '~ -c~ t~ -01 -  Bst  Ast  Dsu  Cs0u P -oʥ `1 -w! \ -_ sЈ ۣ -1 y -1 k% - { _%-1 S%- 2 y~ -H2 ~ F-~ ~ G-~ o J<@ -͡ 1i <  s2 -~  s ~ s2 ~ E2 h{ -2 e -h* ~ < 3 f E) -Xy 6 >d ~ H>H3 { -p3 { -{ ~ -3 -4  K-04 |Lsx4 u} s/  s4  s , p3 O Is5 -  s`u  >u -  Bst  Ast  Dsu  Cs0u -w! \ -_ sЈ x[ -U -͡ 1i <ݡ -Xy 6 > K -q & -H5 -  Bst  Ast  Dsu  Cs0u -w! \ -_ sЈ -  Bst  Ast  Dsu  Cs0u x[ -  - -͡ 1i sݢ s# f  s -h5 -Xy 6 >5  F5 _ -5 r s 6 Y| -H6 k -6 & -6 K -6  -7  s07  sh7 -w! \ -_ sЈ Z s ! s$ ? s7 -͡ 1i <ݡ s# FE  s _ -7 -Xy 6 >  Fg - r s Y| -7 p -  p8 @8 -π - s  s% < sE -  s`u  >u -  Bst  Ast  Dsu  Cs0u -w! \ -_ sЈ -͡ 1i <ݡ s# F -Xy  F 6 > & -\ K -h8 & -8 v -8 6q -8 -  Bst  Ast  Dsu  Cs0u -w! \ -_ 1i #<ݡ 6 $>  %s r &s 's89 -h9 - D - & -9 Ł I-9 .sЈ -  Bst  Ast  Dsu  Cs0u -  s`u  >u -: ( -8: ́ -Ձ -`: - _ -: }} -} } -/ -: vp -  s: Ť <; / s0; h -X; ; D <; )<9 (/Q *:n ,-h +- -- *l sn "s< !s -0< -h< -< s< s< -(= Ƃ sp= ͂ G-= ۂ Hs= p= -0> - -P>  p 7 -= P Fs> S -> -w! \ -_ -͡ 1i <Y -> -r -Xy 6q - - - -̃ s - ?  -@? -`? -  -? -  s`u  >u -  Bst  Ast  Dsu  Cs0u P -o ? -w! \ -_  -? !< "< #: $-h %- &- -*  p @ > -X@ p@ C -@ ѥ -@ c1< L 2p(A Q 3pPA  sA <A Z <A e 0<k 4pB 5<8B ~ 6<hB  ;sB 7<B 8sB 9s C x:s „ <sPC _ -C -DŽ q s؄ x sC { N  ,s  s  sg g 6 > -+ gj -H Mj -C b -D v -(D -XD K -xD - - ۅ - -D  -D  -E ' -8E 1 sxE 8 <? [ <E aZ.<E f /sF h 'u@F d )shF  *sF x +sF d]-< (p -s  sЂ  s  s  n  n  M  s  7 sD X sb { -(  -  -P  -  -  -x  - ! -Ѓ - - 9 -F c -n } -0 - -X - - -! ! - +! - 9! - G! - -  Bst  Ast  Dsu  Cs0u -w! \ -_ -͡ 1i <ݡ -Xy -† 6 > -  Bst  Ast  Dsu  Cs0u S -چ -w! \ -_ sF l s |s -G -͡ 1i <@G -Xy 6 > -hG -  Bst  Ast  Dsu  Cs0u P -o  S -G -w! \ -_ P -o G -w! \ -_ % -G k% - H . <PH 5 sC V sxH c -H y -I --HI .-xI -I -ȇ -I - J  -" < -K -e -XJ -J -J È -ֈ -J !- 0 "-J F -K b -@K x -K  #- $- ԉ %-K &-  '-* F (-V q )- *- ϊ +-K ,-K -͡ 1i <L -Xy 6 >8L  s" shL G & -L sL s o <5 6q -Q -w! \ -_ -Xy -o ! - s z - ͋ - ߋ -  -L  -M ' -8M 6 -xM G -M Y -M h -N 1 -@N x - - Ҍ - ь -hN ߌ -N l -N  -  -N - -O C -Y w - - ͍ -(O ɍ -XO u !-O v "-O ؍ -  #- - h sP 0 -@P -  Bst  Ast  Dsu  Cs0u S -ʒ -w! \ -_ spP l s |s ~sL -P sP -Xy 6 > -hG -  Bst  Ast  Dsu  Cs0u P -o -w! \ -_ -Xy  -P # - Q . -@Q 9 -xQ @ -K h -p - -6h - S -ϓ -w! \ -_ sЈ -͡ --Q -Q -Q -Xy 6 >R r s  p ! -I 6q -X Y| F-@+ _ -(R -  s`u  >u -  Bst  Ast  Dsu  Cs0u P -o -w! \ -_ sЈ  <)  s9 ! -XR 6q -R u} sR o <@ -Xy 6 >R l >v  F Lx s - K -Δ _ -R -  Bst  Ast  Dsu  Cs0u -  s`u  >u S S S -PS -w! \ -_ sЈ -Xy 6 >xS r s -  s`u  >u -  Bst  Ast  Dsu  Cs0u _ -(R ! -I 6q -X P -o S S -S -w! \ -_ P -o  S -S -w! \ -_  -T  s0T  shT -Xy d-T & e-T % f-T $ g-(U \ -HU ) -xU U P -o , -w! \ -_ \ -D ! -Q Ă -a բ -i C -q \- sЈ -͡ 1i <ݡ s < -Xy 6 > Lx sǕ -I o -U [ -ٕ Y-V -pm -PV -  - q - 1 s9 sE A sU "sb spV pV l Ԃ -V W -{  pXW }-W m FsW m GsX _ - -  s`u  >u -  Bst  Ast  Dsu  Cs0u -w! \ -_ -@X sЈ e - 1i <Ŗ s# F 6 >d  F -Xy K -pX & -  sX - x[ - . -X : -Y *l s@Y  sxY -  s`u  >u -  Bst  Ast  Dsu  Cs0u -w! \ -_ sЈ -͡ 1i sݡ s# f* -x  s x[ -B _ -  sX  sxY -Xy 6 >  F & -& K -X f -Y k - p -Y r s -  Bst  Ast  Dsu  Cs0u ҥ ֥ B _ #             " ff{%g %h%i%j %?@%@r%%%% %%%&&!&# # >`` `- @ @!<y]&f&o&x&&&&&& & & o&&&&''"'0'>' f{%%%%   r bzlzL'S  H | s t   Ӑ   ' S  _ ߑ C  = ] >&W  Z S'G& M&U&_Y'a'i'q'y''\dedndwdd d d@ddd} dddde e``e`e `Cm % @`e&e3e;ed" rjx}}}}}}}}~ } ~ ~ ~'~#6~I~g~x~~~t3~~~~3~+! )~- /#1*ć  | p[x[o@ YHa:& oo 9oo+oW0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p   0 @ P ` p            0 @ P ` p            0 @ P ` p            0 @ P ` p            0 @ P ` p          0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p   0 @ P ` p         !! !0!@!P!`!p!!!!!!!!!"" "0"@"P"`"p"""""""""## #0#@#P#`#p#########$$ $0$@$P$`$p$$$$$$$$$%% %0%@%P%`%p%%%%%%%%%&& &0&@&P&`&p&&&&&&&&&'' '0'@'P'`'p'''''''''(( (0(@(P(`(p((((((((()) )0)@)P)`)p)))))))))** *0*@*P*`*p*********++ +0+@+P+`+p+++++++++,, ,0,@,P,`,p,,,,,,,,,-- -0-@-P-`-p---------.. .0.@.P.`.p.........// /0/@/P/`/p/////////00 000@0P0`0p00000000011 101@1P1`1p11111111122 202@2P2`2p22222222233 303@3P3`3p33333333344 404@4P4`4p44444444455 505@5P5`5p55555555566 606@6P6`6p66666666677 707@7P7`7p77777777788 808@8P8`8p88888888899 909@9P9`9p999999999:: :0:@:P:`:p:::::::::;; ;0;@;P;`;p;;;;;;;;;<< <0<@<P<`<p<<<<<<<<<== =0=@=P=`=p=========>> >0>@>P>`>p>>>>>>>>>?? ?0?@?P?`?p?????????@@ @0@@@P@`@p@@@@@@@@@AA A0A@APA`ApAAAAAAAAABB B0B@BPB`BpBBBBBBBBBCC C0C@CPC`CpCCCCCCCCCDD D0D@DPD`DpDDDDDDDDDEE E0E@EPE`EpEEEEEEEEEFF F0F@FPF`FpFFFFFFFFFGG G0G@GPG`GpGGGGGGGGGHH H0H@HPH`HpHHHHHHHHHII I0I@IPI`IpIIIIIIIIIJJ J0J@JPJ`JpJJJJJJJJJKK K0K@KPK`KpKKKKKKKKKLL L0L@LPL`LpLLLLLLLLLMM M0M@MPM`MpMMMMMMMMMNN N0N@NPN`NpNNNNNNNNNOO O0O@OPO`OpOOOOOOOOOPP P0P@PPP`PpPPPPPPPPPQQ Q0Q@QPQ`QpQQQQQQQQQRR R0R@RPR`RpRRRRRRRRRSS S0S@SPS`SpSSSSSSSSSTT T0T@TPT`TpTTTTTTTTTUU U0U@UPU`UpUUUUUUUUUVV V0V@VPV`VpVVVVVVVVVWW W0W@WPW`WpWWWWWWWWWXX X0X@XPX`XpXXXXXXXXXYY Y0Y@YPY`YpYYYYYYYYYZZ Z0Z@ZPZ`ZpZZZZZZZZZ[[ [0[@[P[`[p[[[[[[[[[\\ \0\@\P\`\p\\\\\\\\\]] ]0]@]P]`]p]]]]]]]]]^^ ^0^@^P^`^p^^^^^^^^^__ _0_@_P_`_p_________`` `0`@`P```p`````````aa a0a@aPa`apaaaaaaaaabb b0b@bPb`bpbbbbbbbbbcc c0c@cPc`cpcccccccccdd d0d@dPd`dpdddddddddee e0e@ePe`epeeeeeeeeeff f0f@fPf`fpfffffffffgg g0g@gPg`gpggggggggghh h0h@hPh`hphhhhhh h { }v! Fq @C_8 B < F o p(1` :}i0vHK `E @ ?S p`>Z v+f `<m 09u ' 7\ >`*( 5 4\ /~1(| P8@'  A I@ j 0pp |  `  n~ p` `  `x  0   hÎ 0 `̎ pV @ӎ a ێ pf  k   # @`   ~й k%p t 0T |     bz  l m z    & / 8 A J S Z e p t @ @ @ @ @ @ @ɏ @֏ @ @ @ @ @ @& @3 @@ @M @Z @h @v @ @ @ @ @ @Ő @Ӑ @ @ @ @ @( @[ @[ @$ @9 @> @C @= @H @L @S @W @Z @_ @c @k @s @| @ @ @ @ @ @ @Ƒ @ґ @ߑ @ @ @ @ @ @ @ @' @/ @7 @? @G @R @] @d @k @r @y @ @ @ @ @ @ @ @’ @4w  4w  4w  t \ asn1=SEQUENCE:LDAPMessage [LDAPMessage] messageID=INTEGER:1 extendedReq=EXPLICIT:23A,IMPLICIT:0C,FORMAT:ASCII,OCT:1.3.6.1.4.1.1466.20037     q `0!?܌`0&9>dQ'^v͆3;<~ w"0qt035V4Go;X ܏pAzҚ5 W wTt>O|Lfέ=P!mĮ8bl ي] {1;VhU t WmNXOXWt|K]DX .Lr"]+-`V+!9X7ʣwn3m_3.4B_ <'~݇UiUzq]:xC)I^yG.c礋TD]c,~e% O:J褃Ix߬,7>yU؜l[z[[us'y(EX#l)PQ8L5{0^t?.3tu Oeo7ͶoP^}ֻ@Ն&A>s*M\-j(uL#,re<%? Nnzzy0 -d tHN5PD0Jmk.5R&7 o{@bo]/; hitCJrl.4^v>EJzg81{T Xٔ]^PkW*];)!AG UMp⊊#6)TfX }]lHS+G4>?VCeZp>b?[P]gb)m]W 2j5](Ą%c>0WE4:wa=J]yK/%(iw|Ju.+P2COw" iX 5maJenbj9 ANHs/U7kE.&c"^ͮbN-iOA~6)Y7d@2&0`nԳD3LJǒB6>tcY 6E+6^ʫIӫc W<I]^#8 "]V2nic'NXpNl^jCElf\}\xU3K<;XyjSiWq[BI薀H|t~kT75{9O.ev XWn?L-F(:H峄GXŬ#͖^A{KS ImQم:b1\nM{QY\̭˓iqc3;#z=ok[ښٕv8ӽJpM‘MT,ߪw(*,|& QMvvEOvq,T ouMʓH0J%/I25 IBљ#*!Q'*I ϞD'A W6\~t+_j3,*'Wj@OL:].꽂^Cqշx:D&eSVODUG?B߼ iT[|IϿBOd儇 p%8ӴxO?NKsz{w,å12U5wbFa00ࢌ)D_MR("6eT_- Nۤ/7A)G7Z?AIWΠ??FtS0Mnrsy`.*}|MD؊P):)ٯ:G]33[J_[88^΁DfbdOv#ak÷3cx2; Xꭼw1Y% .b\hv#E P?Þ;TU2tF,~` {9Z qE9MڍDH1%GۘVfHLl,TCvvh oՓʛ0a ʙ/fVJ.4U+J|gmk[́\:6zдW&e=;<IJM1^O=f"}Ư<>oz/̍"(%ԔӪЅo Ur >4, E'/U>xx.әl?v:0v0JPXԹ4BNGTEeKЅS~Y Wj؟w@c!uv'A0_Ƥ0S6.ٕ)F`'o>1*N|.AO#!MtD9iK.v^De1 ,g=.ӗTES|?ɬ kr$BCR-Ӊ(vUg9ٷ jQz:;A[]3hSdÊFDloEg<"Gzy znS옂W8U:Mr7J6T?g׸nO`+Z Q30F&8ɗ2-Y8ffN{c?ҭB) (YX}\C~ c-a3QFCNa(epC!v{@'>kwmΚw١@k!ܖrϕ^%`9Tlu88MB%f V&MXqjܐ6nC,NfcHо$#.0;/3x n3' 71MC̠I-7Ӑ_1iK석+ݛX((Tl% OG®/m)=(CLyYuwVCڬBʕs&T:7d1@YrMa!BLx1|{jT8T/ڟyBʺ!+JN5=Ů'0E;C>5 S2+]XҫSeIHM]`EJ`+7c XC~ܡV^i0~v_Xϻn2Ho|ȏӆ"Iܒ Mvg@[TfHYU;췈0rBe⑧ERQ25#< ճy[Gֽ!i,cnʄ02-I*@|E6G~.[v쉌%w۔"ѩc۴CN/hP /[Kcz0.e(왡ztTЯXNP~1 ם0&0HXTZ l8y9/^!y92rɐί &_.^f/}"mh>nēB dR\ AxRv?k "r{C &&Pzɡʨ,W>PEz,Y{4谞'Ż0'ۤ7dȆLdNL{̠q4HF7ΰM9/|ϐ[7(BY5Fn)zwg+6ׁ]8hI}<60z!u`>BGI\i}<5lcbaa\bb #l=,Kr'6e8WjOQА#e<,0Z8byK ?_F&[(MߓŔKB5kiav 3 KˑzGyW= InF:˴[0% 6Z1scnTSiT؄р W&Ed+E7W0.]tRރsa!b0l6Q{QI'ݽy9=emR`ȋ3׾CM+FTDRdGlJd?!/r|&߀PԔ}qدt63XcseD %ݘݼ ,CA¡7pZj06!i>8M4G~&%&NUMJYd~r}}+,܋R V&yq Y'h=6Uwi?cp!7бWzc V;YljT-x}N [b; $N=Z>=83^7L+X%X#ƃx݉ nk7tڠZ+( Pd~(;&9VrMg7,n1Yx]'E1!ά~2v1ĺZɞt&nmC b4IʓBK#yXfܫ3"+\{.RrxJISv-.C<9ta3*UJ痦@ARfϿMɾcv58y#H`8_kg[A ^KN[Gb#ٶ.]l|U Ϭ7jO@yJy&5M>9l9_RT$|n>J@lcDRSQG.N :&S ũ֊)uͶ{d|~ HJtLS={jw/,yD7;=)ˉdKWk '/= <s}pieKtI!d3P3b[ rQ2:dsh[p\gE`W+G "sV3> !+nk ݵI6옘 ~gjz Q͡mTi j^ \g-f3"X陯 *Vm@7gzT[r֥#9xȃtyž =4D+"G1ke__]Sp7M|Jуܲ=xX9P-D#6_ߞO㌿>IyXG/!c2culnhHY4C Tg!8 @..JQݺ#f*ʜl-k}hRV/U) N] +֛Ҙ)E\UeͬSFߥX|.FF/֪!~vb; 6yUd*N;D|N7&xm$kH!g"@?զ^MUq–%GDoS+wf~z(e1ׇ)[tQ{Ѝrw oI~$2pYp}Ėa; 츜 w'5fF1jR] ,4zj!B1H'y{QK[jqE07ޢh -Zݑc_yڙ :KCpWĶύ*#o_J'2$d,9/K~e\nĶ+Q.`ug+vAB)ʷa: odqembvmkx"2cS}흂,\݅Ҭn`.vʱrP[9|ioIRg#C,|;ea޵cslp,s쇒 g֜5HH;DsY{vM[/_)n7֪O^R0 'FezC!Ipч)6f-{ 8َx'ϵEX=!Rhax(l_\=A. _5P3},;$15sƘxf1ͦ _Y:5T!j+qf;AR2RQU2O;+amhy4IC|N^1 $"5̢ [eqd>3NAT2x~OFjx?_g LQQJXd٢2T68 `2jGA;~Ŧ3gl~Ô,,iN{@M*'Z-?}QpP8M6y.+}/J ޑǯ흸le^gb:gWVJXnp)hEͥD V&ХIn"{X:RL\|{2Nd%k}v"S1kץk8 '3󚮔 m'U)?&T#<\.!#%.oT{ka Qﻹf,%v˿z/V3ّ1rJ!BNl'"峣瀻Rdf%o ;6.+OƱ[ {5-D>DG&q{mK,l!ΓI4iI>q[~^T<) Ƥax~ 국h ')|p* 9vr0^JUF_a%z=o+Ij¡ 1BCN||`貐! |cn[i=w;&'*ܕOB m 1!8\yAt (R/M0ŦaBOfc5-;q% F⧣ͿX%_ *FKfrQ6Rq!O+&PL|.Tv%H9o$dcDol?/xӷ&ۍ7M\åuLoXU2n+EH@ع<s[qw?o6Q_~PzM֣v$_[\dq6a'}}՜ZTUE-XR(eRE+alY{땁)R25ʑ2bwC,Ax'P."볥' &~9r"cyjUaA7)RN1D.A  ·bh'[ZzKs@xB(^qzx>,9r,]Ǯ)ha7}} GhFVm{Q{5 z*CH#ma@c+/aLp=xO 5mm79}3TӃe}':k悎X-8l;GXpMF4` <@2u#lWs L\~Nus-TUɼ˷Nj }Ј!C s}T}c^' n~Z M9;|s9Z}r2XqnfY֬S-FX.M}JLWTY,m=*)`DSԩ~!n^SY7qpc*)ךvGN1O*ejKCy8A65E<6Hw teThD,͇;) rLTfA=>_/Xh1WuM8}V4+@|"&}W(8qy!BRfJnGպ7|ocDݱ0mͿ4'Y}yܖ[N@k:dp$\t^gJʾNH}YbPSF[Z=spYk^*jN#8ֳ q-ܥ3ݢ>XSnx5xCcut q$aSM9 "/ԙt:cLZZo)3P'grcȈKջv۱כoz\,`. m+yF$\2T/xs u#Y[$u/R! %]OEʠTo"Ͻ#􏙧g;I5O76u% l>-29K__n~Qٳ7@}rS-~`I1Le:Mc!xk@[Iu#;ŀ`'zwK>uC&qrprp%j-yeN}\[7CfHlgdu6%Ut,(v= jZc>1)~3K(-:Q&.)G]c)emxc1rTsr&HWW('b1XzrnEg&%dE186FNq_ AȔs0Tv#"zB2Fy zy=2b)s Q#>t$ `6*(M憘|!3T O|mcs* 8Q#7f?Gos!ktOš2n2Bz=yCzC FxMg)+_pJjZ¬ǭ b,?VPr*؄1c' ^x1Kw\P7fkT]nX TF~ !1^ g2V XVB5ld ?f_>9]2Hle4P[.y b5ohiH]4ArZqGo@@pc6;)0 )qC;QWq+e!S_()O|D(AOj(P9gS,<˖A@2pe:"yj̙r}m䐵pNH`*z=$)ڽפ`-"ek(/y|CBjEO.4T}my.QMyVD7ZHH?,QFAƑrUs,tP:/mwmE i'e^4Ӂ=0C#Bv1sFa 9@zۀ, 4ԒlnOϯLwvrGќJ3nuv1w)R.R0u ͉ lW'=/\v)K xraao9N>Ǐ68%zJԠ>!9r=P]_?mU ![&+wOv,"j办VxD^`ey1#.t॔KXU346Wy.;N!\HJ`)S--o B.q1mo+#ߴ@, }}Kߑk iif[F}pm~uNwMA?bq^8K,0oI.ɚ] U:%#Вã/MUZ1u,A_uc,h˓QsI`&FP_YT͘At_ `{< 뤓ʚ'e[yn&(;smSX`\vCX$; $ET7c}t!HĔD"-->Z1ܕAX@_ڬ?*kX_Hx $< %kBl61z&v jb |I wgG!?C!F0bQrHg͞!0A4w>9g*{/@pO? vJ5NG+]tC3{I@fbz˓SԀH'KAa߿=q %qJWl!}5EjC\T_$.@ޒ#YҡL e[·Uq< $ka3B+wtyyϭW5 tqXk2]vH9#wJp>lR$ AZz^15uĖt۴Ȍ;fPGeb4X5j,Zhxdk>Nz¶vœjiV4J n5`#0d9`vQJ<:, `iJ!IT X!QG>TFٶdT/ϥ(9v[-C$oio}_x@ (eƞVpRҔJ%L.y\ՎTU%vcP"/XXykAg&lWa:}1-8b6BB$ge |oDɫLE{80X+] TIM"@P.x(x$V—,Cfr_S챱^@ H{?j!5GŊO^c`q[JO`ƺJ$ .:΍'! QU0c׍ąN'|.墣Lc9wfʠqP=5.`haCʚ#JEraww*-Va^jFJ?PֺוeSánCӁFFHNy@4q^J^Op-=:ը  9_!1trkd5a 9!f |ʡZqT(pCl{hMEF C,FN&.۰U*PD!0;#3ʣLR6?` Q qw:0!=$.:%Bjhyi.˹-Q5˾_XT0wP/W Bʅ sG 9b?g]$`)L='jPF<#9Zb?J^ISuC)"Ń Wm"$+Kg7ۏ8CD?LS.=fL=1lߖ3#GYu)wԐ ?LէA󀎱c?+sսQjȺMT8Шu"aQcOшI0G0\u؉EQ!o0o3$  (#kL:%OyO9]_4T@LZE ߡjpwFD+u2l'i\sGd+B/,i'ѵ#Ņ-CMIt~$ϜE@*(@)ɰ#~2Ƀѝ>շ}ec]]ύ p *q}ǸbpJO6%jF߾wVm%_[7̹J3cCCC@)|+6S} MRt_!\:Z%!vL|qPq'[# ![(=%*-}x~ $*\*hoVs:N#"jtx?DwQ0>|I ˊf$3;@VP澄 %Ӝlb]+}=zlTQ [GdUZ7%}!ioɊ@zp NFz۳˃#ĽԪ]1FΞugSGD%s~ЎYѲZ/9ͣ¹ǹHƘMʄl)Y5dY!3kQ^޸_ƹ"eFD#33kYtj>6P!Бl/&0ej0VboVqIZM4Xy0UlZL,YV蝯 xQUC;l -A(Пj~ Ы|}5'IQcd>amS9'Ogw:o s>z(a#+΄W~%Te̕ 0YakNCy% Hh f+vFNY LeHxC,$}ZpEl)@?[GD9rzڪ* T#7[a ~$sm@r HlF9OxFj1d 8<*+16`-t2蜓n{q%8*7Dΐ?RR"8v iXj}|,2O 7C]$'FTSbq+qAu:a)F:ck0N% U˃uk4A)jUMp쮇8 EwnW`W"ˏ3:7o림Sp!v>/E$Y2.;#x=gO7NGL-OA.-",SU+?X:0ڰ-O&8=pQQy2{-'ŜyRS"絮nUe LsjI)aF X׈^{BXEA  1W=[/_OGV? )[Iz*!,IOQmKKR,:3MӔ> btơu1lՅePfeoSP@1VSz"Iq,xY4cO/<8?~%r 9캐[:Xl0B71jj )F˅ 0^9""4ah7=.J[HcӖd4ѠѮl/HC!0_ޣpx. }nBܷF6MF=ʼns;lIǟ D0پ[_׉t),TQޠ/$kwޢhR %]oO4~o0o٠]\ A2 ¢~h\(!XcLNKMX\Ug}n To@gL[<zgi @v&CV(_;i6,Qw/W{b;@{h 8!]F#rQFyٽ,W~={k&'jw,B҈ӒQd\lG %??! ]Te}ðhϛ?nAj)}G0 j3=S.Ys>u1GzR٦{8h~KS[Yqenfk6(ץ,9&Kښp7V#^9OCeòp[PIi&+pSFbP3K(1gPޛ~, Pa孽6N@} K h__;kܾz:'IC=~,^{nln8]V}S>$ k2g蠋kE vϑ}!ڻbG6g茪8ae8`$ԜLz"   bzS lz1&| s H ߑ  ' >& t Ӑ  l G& l M&U&t ldDd  @HdOdK SdXd_ Ce(WhWW_ WX@XxXXQe_ X(YhYyyyyy@zAzB!z-zC ^5c9z @zGzNz Xzgzrzzzzzzzz{l l l &{4{F{X{n{{{{{{{ { |  |9|R|k|}||||| ||}} }@-}?}[}g}7FTbw   "->ReqCĀ ؀ #(6*G+`,u-./01́2ہ3<FG'P7VOZ^dpmnop؟qǂrst0'/8openssl-3.5.5-6.el9_8.x86_64.debuga(7zXZִF!t/_]?Eh=ڊ2NE&'+k*ITO+j&|5=] #'kyb`o-`Q6f`Hr\ _ 緗] zvG~kk EYpUa A7ú lt]҂6;Ƕk(C X7gK4 >RCQ^훆)Mڙ:,jePDl!i  sMy(xD^5oBZ{J6p]tgoz{ҧǽ X?gl$|68@x=~8\_$Yչ@9Y;s.lo6Ewp;ED:i 쌕T)2ah)IS(h7mi1lef_A|H;#/)wdr싓4SekiÊfWLyN29tF~o]hKT9V T*t{7K UwXhhr<0#ȸk甃(3;ȨKQDk6\>%/Tz9 4NP/R+Vrh@z ;BrS/fds;4c26\g)V)!߳?p]kY]otOxƬy䯒7mb VҬ$XHlȞa=4!G쟐t|g{Nbf\[V8ND1']O":)ڠ~&A6,b3lEp &. du| S,{o^hſ ΚmT"fI=OaUJDMQrV־Gg$4:dײ?-tj TP ^'іT54#-םDB,q8VqEPJRȍjQ)#')myB[DzFaE68}o1\ ƎZLCqmb+F@^7s.sbc/_:Jzn333*fI!`ܥ~\0m\b) (YDPmRʡ?rz_9taӝg_bȢDc( $KP%hZsry`YT u\ꪠ= _ ]w=Śᒈ *R G[gBz xN :7 gZH,I84yܰ&c}J2`N9jW/6iM!ފ=Ib류ajA XpIGQwI[ޒEے Q7?>l8FOtw\h$tր 踚V =X[:9Sb\ p02 ?P閟0bRU?F.]0ɬ_M&t 5K1بG皾Aբ`n oywP(_ɘ#)Ga/]Pu}[:9S&'fuo$ѱҊL#mU>QB[b1o|Wխ SXݘ>ȍBG>*dR׬1 k`je$hZ{nhwʝivLW}|֮7# SY>x+VB50ITK;'CL[|/wN,ƷJAoc&B(XuN&GS6۾S8)}lVG`3;Zc;Y鲙:nLiQDsK>Cj+qm~]k xQ2%/8čeԍo[J>|K>|#@T^CŇ G:+1QXh1H`#"I&T&nă]mdrǰ6&xdaX,cVC~8 i'$55~$ L#w{Zv]p3ܯ`yBQ/l`69XTZ#>LbM<#ƱlFBS!p"yoHC{[@ 8KK~60V7_ae2Id(7&R֟Qֿdq@tzSMN:i(-a6aQC|9B#Rı+): ~/fH/= ;&k4s-fjYm65:OFT$c%w.Kfk{^]LXsKGXϺ7Ee,5{ej &@ uOa=ٞĩ&1$n凌ǽ6@V6*0j"=3 x!n;0+c'թVx#|ziԗhxGKSZ8HOџ97]ɐ霩1A"3ѳ6У"ྥYǍPLLN2D`vWgaU[g4X801?rg`-G*X^jU +8Ʋ@B%ʥDb ӥHsyb n,#sD~@T\pXl8ց-3eUA#S[cVC &KmZ$ت>La9lNk+2@*xٙg湻j >I3gFKx #6U˄>23oq`$/D-WIYÝねV %R[R@& W22zcngyکgZ/߰B݀4:$,¸KFmRPH-pLU&d,lwrrkB;So] [T1,ES%x֪ "D#Dx׊C" aLo_7sX>asbyCS&bko!1LWRkq0asYX$3k ar˚wgr!ê0%o{JeQ*T/}VwpZC"# tAˊsp䤾q 3/U!h+`d :}K Ҧ(LY-+Mx%(4Gr^M _qN#gC(О M0 ov SDԧCŶ!u1. N(+ yܗ4};,hoyߦP,ԕFJ/J()<'[A+&ePB1=.K$cEˇBb+wLD*!l\'e/}UcȷH#-Mz`@Fod\HORJ"?ϘA嬛M__>/n\'l%ZH߉ d@YX?m{-8|tm+k{sHiL0+Н)wsɍvCuEJ=Y$Ҥ5{xzo*ѷ{ Aqb)z0>c Qn{2И  9 j;2LMcvo;53:d'HZ4@ _L u| iY>=It7N$4[ w02 )WYe'vO ,KE㊨ ,(K*v9z5sYd'śU/ư KɌ nYHsj(圡L2\}ء}[)_*Zv<j5H`EGO5[!~hkAԢ8&'kdԸ]9ZėuIqrą! lȒG ͠R6+mTdN@a"EC3B&:TgYZ.shstrtab.interp.note.gnu.property.note.gnu.build-id.note.ABI-tag.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu_debuglink.gnu_debugdata 880&hh$9 Go0Q `Y@@ao++H no 9 9`}::&BHaHa  hhhhpp /| |    Thhp[pKx[xK[K@ WGYI 6@~ @@G @(hL(